SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004729 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004729
Domain Number 1 Region: 683-863
Classification Level Classification E-value
Superfamily Fibronectin type III 2.04e-26
Family Fibronectin type III 0.00096
Further Details:      
 
Domain Number 2 Region: 340-442
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-24
Family I set domains 0.022
Further Details:      
 
Domain Number 3 Region: 449-540
Classification Level Classification E-value
Superfamily Immunoglobulin 5.33e-24
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 554-653
Classification Level Classification E-value
Superfamily Fibronectin type III 7.92e-22
Family Fibronectin type III 0.0000496
Further Details:      
 
Domain Number 5 Region: 256-353
Classification Level Classification E-value
Superfamily Immunoglobulin 1.38e-21
Family I set domains 0.0062
Further Details:      
 
Domain Number 6 Region: 168-262
Classification Level Classification E-value
Superfamily Immunoglobulin 3.65e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 7 Region: 64-162
Classification Level Classification E-value
Superfamily Immunoglobulin 4.61e-17
Family I set domains 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004729   Gene: ENSMODG00000003861   Transcript: ENSMODT00000004830
Sequence length 1386
Comment pep:novel chromosome:BROADO5:4:271944805:271961203:1 gene:ENSMODG00000003861 transcript:ENSMODT00000004830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRYLLKTLLQMNLFADSLAGDISNSSELLFGFNSSLVALNHSLLPPGDPPLNGSRAGPE
DAVPRIVEQPPDLLVSRGEPATLPCRAEGRPRPDIEWYKDGARVATAREDPRAHRLLLPS
GALFFPRIVHGRRARPDEGVYTCVARNYLGVAASRNASLEVAVLRDDFRQSPVDVVVAVG
EPAVLECVPPKGHPEPSVSWKKGNLRLKEQEGRITIRGGKLMMSHTLKSDAGMYVCVASN
VAGERDSGAAELVVFERPSFLRRPVNQVVLADTPADFPCEVQGDPPPHLRWRKEEGELPI
GRYEIGSDYSLRIGRVNAEDEGTYTCVAENSVGRAEASGSLSVHVPPQLVTQPQDQIAVP
GDTVTFQCETKGNPPPAIFWQKEGSQILLFPSQPSQSTGRFTVSPSGQLNITEVQSGDAG
YYVCQAVSVAGSILARALLQVKDVFLDGFPPIILHGPSNQTVVSGSAVWLPCKVTGNPEP
SVQWLKDGQELNSGDLRLNLLANGTLHITNLQEGDLGIYSCVAKNSKGQAIWNGWLRIHD
SVVGSTGLPPEPSGPPGSPSQPVVIEVTKNSITLTWKPSPQAGRSPVTSYVIEAFSQASG
NTWKTVADGVQLETHTITGLQPNTIYLFLVRAAGIWGLSEPSPVSEPVQTQADSGPSRPV
EDPWQGQQDLADVVVQLQEPLFLSPTSLKVSWTVDGQSQLVWGFRVFWRAVGSGGWTVLD
TGSSGQQSAVLTELPAGVRIQIKVQPYSREGPGPESAVLTRSTPEEAPSGPPQDTVALGG
DGNTSITVSWDLPLPTQQNGIIHQYRIWCLGNESRFHVNQSAEGWARSAVLRGLLPGLLY
RAQVAAATSAGVGVASPPVLVHLPLPRDPEPGPGLEMGLGLAERLARVLREPAFIAGGGA
ACGALLLGLCAALYRRRRLRKELSHYNASFAYTPAVSFPHTEGLSRASSRPPMGLGPAPY
PWLADSWPHPPRSPTAQESRGSCCPSNPDPDDRYYNEAGISLYLAQTARGATAPGEGPIY
STIDPEGEELQTFHGGFPAQSPEDPGAWTTQYALPEWSQDDSDLRGGKLKILGKPVQTPS
LSWPEPLPPPPPSCELSCLEGAEEELEHSSEHDEWCPPLPERSRLEESNLSKDCRASPSH
GNIPSPTPSYGDQSTATLTPSPPEPSQPPTEIVCIHHTPRRVPAGASPPLSLSQSSLSGL
EGGPVSLSASPMPPRHLSPSPVPTTTTTSGEARLPPREMASSPPGPRARTRKKSKATPYR
KDRSPGDLPPPPLPPPEEEASWALGLPPMGNISSMERERRGEKRMVRVAPPGSHHASHPD
GTVIMGLVGKEAWLPYSRPSFLPRSQGASACSTAGSNSSRGSSSSRGSRGPGRSRRPGGE
HREVKL
Download sequence
Identical sequences F7DTY9
13616.ENSMODP00000004729 ENSMODP00000004729 ENSMODP00000004729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]