SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004744 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004744
Domain Number 1 Region: 28-206
Classification Level Classification E-value
Superfamily Fibronectin type III 5.11e-20
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004744   Gene: ENSMODG00000003874   Transcript: ENSMODT00000004845
Sequence length 770
Comment pep:novel chromosome:BROADO5:4:271962660:271971291:-1 gene:ENSMODG00000003874 transcript:ENSMODT00000004845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPVELLVMHVQLENVTLFPTDQIPGPVVWLSWKVSGPAAPAKVYKVLFRARQSAAGEVAG
QPDGQWSESLLMGRQSAELRGLSWGYDYEFKVRPSSGSAQGPDSNVLILRLPEQVPSAPP
QAVTLTPGNGSVLVSWDPPPSETHNGIIRGYQVWTLGNASLPRANWSVVGGRTQLEIVTG
MPGSYCIQVAAVTGAGAGEPSSPVCLSLEKALERAARDSVGLGPPTLEQLQAALRRPEVI
ASGGAVLWLLLLGAAVCIHRRRKARAHLGMGLYRYTSEDAILKHRLDRSDSPWLATTWRS
TSGSRDLSSSSSLSSQLGGDTRDTLDCRRSLISWDPRSPGVPLLPDTSTFYGSLMTEMSN
GPLIPPGPRAPPMRRLPPQLARLSNPWPSLDSLCNAPRIPSSHLSLTPTEAWRIVKKQEL
HQANSSPLLRANHPMGHWAWELAGAKDFKNISQVPGAVPRTLAAWRAIGPQLLNPRNELA
SRPLPPAPPSPIGGASNKGQQNQSGKDFMEPQIPSSLPLAAAISPKPPSPLASSSLSGPS
PTSSRLSSSSLSSLGEERDNVLTPEDVALCLELSEDDDETPRNSGTPVRRAPSPPTSYGY
ISIPSASGLGEGNAGGLGPEGGILLCPPRPCHTPTPSEGSLANGWGSASEDNAFSARASL
VSSSDGSFLADANFAHALAVAVDSFGFGLESKDHDCVFSDFSPPPSPQDEFALTSTLTLP
AWEWSSNWIEEMENKYSHQLCRRLPSSPPEIEKGPSQGRHKTGPFVPKTH
Download sequence
Identical sequences F7DTE7
ENSMODP00000004744 ENSMODP00000004744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]