SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004768 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004768
Domain Number 1 Region: 136-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000054
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 36-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000212
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004768   Gene: ENSMODG00000003891   Transcript: ENSMODT00000004871
Sequence length 418
Comment pep:novel chromosome:BROADO5:4:271986467:272005241:-1 gene:ENSMODG00000003891 transcript:ENSMODT00000004871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRERGALFRRSSAPSLTPFVCLLLIQTGSLEGVNITSPVRLIHGTVGKSALLSVQYSST
SSDKPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQTSDEGTY
EVEISITDDTFTGEKTINLTVDVPISKPQVVVASSTVLELSEAFILNCSHENGTKANYTW
LKDGKPLSNDSRMLLSPDQKVLTITRVLMADDDIYSCLVENPISQGRSAPIKLTVYRRSS
LYIILTTGGIFLLVTLVTVCACWKPSKKSGKKRKLEKQGSLEYEDQNDDHVKSEVETLPR
SGEHERKNPVALYILKDKDPPEGEESSAPDPRSATEQSPPGYTISSAAPGRSPGLPIRSA
RRYPRSPARSPATSRTHTSPSRSPSSPGRSRSSTRTLRTAGVHMIREQEEAGAVEISA
Download sequence
Identical sequences F7D8L0
13616.ENSMODP00000004768 XP_001371494.1.35504 ENSMODP00000004768 ENSMODP00000004768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]