SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004775 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004775
Domain Number 1 Region: 5-106
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000395
Family Ngr ectodomain-like 0.0066
Further Details:      
 
Domain Number 2 Region: 357-440
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000109
Family Fibronectin type III 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004775   Gene: ENSMODG00000003898   Transcript: ENSMODT00000004878
Sequence length 517
Comment pep:novel chromosome:BROADO5:1:621217200:621225312:1 gene:ENSMODG00000003898 transcript:ENSMODT00000004878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQLGWIKDLPNLRSLYLKKMARLKSLDGQIFKATSNLRVLDCQDSQALSSVNTQIFEDTP
HLQSLLLQNCNLSSFQPWNLNSSPVILISLYGHPFSCSCKLSWLSNPGKMVLSRSDDTVC
TPAADPDGTFSPSLSLPQLYSKCHSERHTAFIPGLNPPGTLASLAFRQAEPTPLPALGTP
GITKDNSLRRQEATLERPSLTLPTQGVGSTAVILSTIPPGGAGDTVRPPRAGSAAHTQLR
GESAPGKTAPNRSTPRASTSGATSGSTPFPGQPPRSPSLPSASTSHPRSASSPSAVGIPV
FMLDDYSSEEEEEEETDKLQAEGLCDYHPCRHLQTPCDVLQKSSRCLCPGLSGEDAIPDP
PKLQEVSQTTDTSALVHWCAPNSVVRMYQLIYHPEARAEKQTVVREIYALAREHPLHGLS
PSTTYNVCVLASNKAGLSLTRTSEWRKACATFTTKPSFLFIFAGLCGTSGLLLLSTFVLS
VCLYRKCKTRQGEQYDTHLVSYKNPAFDYPLKLQTLS
Download sequence
Identical sequences F7D864
ENSMODP00000004775 ENSMODP00000004775 13616.ENSMODP00000004775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]