SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004800 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004800
Domain Number 1 Region: 837-963,1006-1179
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.35e-78
Family Protein kinases, catalytic subunit 0.00000000128
Further Details:      
 
Domain Number 2 Region: 682-776
Classification Level Classification E-value
Superfamily Immunoglobulin 9.34e-18
Family I set domains 0.022
Further Details:      
 
Domain Number 3 Region: 243-341
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000445
Family V set domains (antibody variable domain-like) 0.069
Further Details:      
 
Domain Number 4 Region: 350-432
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000257
Family I set domains 0.051
Further Details:      
 
Domain Number 5 Region: 573-671
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000222
Family V set domains (antibody variable domain-like) 0.034
Further Details:      
 
Domain Number 6 Region: 32-69,96-135
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000546
Family I set domains 0.076
Further Details:      
 
Domain Number 7 Region: 428-467,528-562
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000643
Family V set domains (antibody variable domain-like) 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004800   Gene: ENSMODG00000003918   Transcript: ENSMODT00000004903
Sequence length 1233
Comment pep:novel chromosome:BROADO5:1:385013820:385116307:1 gene:ENSMODG00000003918 transcript:ENSMODT00000004903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRGGFWSRSLWLIIGVLWEAGLVSTYSMTPPTLNITEEEYVIEAQDSLAITCRGQHPLE
WAWPRRWEEPSQGDKESKVGVLAEVGAEQDCEGTDSRPYCKVLVLTRTQANDTGSYTCYY
KYIKARIEGTTAVSTYVFVRDFEQPFINRLDTLLVNKDHTWVPCLVSIPDLNVTLHSQIR
VIRPDGQEIVWDDRKGMLVPTSLLGDTLFLQCETIIRGRTFRSNFFIIHITGNELYDIQL
YPKKALELLVGEKLVLNCTVWAEFNSGVTFQWDYPGKQTERAGAVTPERRSQQTHTELSS
ILVIQNVSQQDLGRYVCEASNGVQSFKESTEVIVHDKPFISVDWLKGPVIEATAGDELVK
LPVKVAAYPPPEFQWYKDGKPVSGRQSLHAVVIKEVTEQNAGTYTLALWNRQAGLRREIS
LELVVNVPPHILEKEASSPSIYSRHSRQALTCTVYGAPPPDVIQWQWRPWTPCKMFSRRS
LRQPAGGRHQRDRMPQCVDWREVSAQDAVNPIESLDTWTESVEGKNKTVSKLVIQEANVS
VMYKCVTFNKVGQDERLIYFYVTTIPDGFTIESEPSEEPVEGQDLTLSCKADNYTYENLQ
WYRLNLSTLHDAQGNPLLLDCKNVHLYATRLEGQLSSTPGSRHATLRLALPRIAPDEEGD
YVCEVQDRRSHEKHCHKKYISVQALEVPQLTQNLTDLSVNISDSIEMRCRVAGAHVPDIV
WYKDERPLEEESGIDLADSNQRLSIQRVREEDAGRYLCSVCNAKGCVNSSASVSVEGSED
KGSMEVVILIGTGVIAVFFWILLILIFCNMKRPAHADIKTGYLSIIMDPGEVALEDQCEY
LPYDSSKWEFPRERLHLGRVLGHGAFGKVVEASAFGINKGNSCDTVAVKMLKEGATASEH
KALMSELKILIHIGNHLNVVNLLGACTKPNGPLMVIVEFCKYGNLSNYLRTKREDFSPYR
EKSPRLRNQVRSMVEAVKADRRSRTGTSDSAIFTRFLLGKGLASRAQPIQDEDDLWQSPL
TMEDLICYSFQVARGMEFLASRKCIHRDLAARNILLSENNVVKICDFGLARDIYKDPDYV
RKGSARLPLKWMAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLK
DGTRMRAPEYATAEIRHIMLSCWSGDPKERPAFSDLVEILGDLLQENVQQVNPCFPPYQD
LQGPACFLKLILFLPNTCYFFPLSQREEEPVLL
Download sequence
Identical sequences F6YTZ9
ENSMODP00000004800 ENSMODP00000004800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]