SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004814 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004814
Domain Number 1 Region: 23-206
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.89e-76
Family MHC antigen-recognition domain 0.000000527
Further Details:      
 
Domain Number 2 Region: 210-301
Classification Level Classification E-value
Superfamily Immunoglobulin 4.55e-29
Family C1 set domains (antibody constant domain-like) 0.0000749
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004814   Gene: ENSMODG00000003927   Transcript: ENSMODT00000004917
Sequence length 364
Comment pep:known chromosome:BROADO5:2:38024438:38027262:1 gene:ENSMODG00000003927 transcript:ENSMODT00000004917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSLLSLFVLGVVALTETRAGSHSMRYFHTAMSRPELGDSQFITVGYVDDQQFVRFDSS
SESQRMEPRAAWMDKMDEEEPNYWEEQTQIYRKNAQIYRGNLETLRGYYNQSHGGLHTIQ
RMIGCEVSPEGSFRKGFYQFAYDGHDYIALHSETLSWTAADTGAENTKRKWEPEKSIAES
YKAYLEKECTHWLKKYLEMGKDVLLRTDPPSVRVTRYSGPDGEVSLRCRAHGFYPAEISL
TWLRDGEEQLQDTEFIETRPGGDGTFQKWAAVAMAPGQEDRYSCRVQHEALAQPLSLRWE
PEASSVWVIVGVTAGVLVLVTAVVAGAVILRRRNSGGKGGVYVPAADKDSAQGSDVSLTA
TGEA
Download sequence
Identical sequences F7GIY0
ENSMODP00000004814 ENSMODP00000004814 13616.ENSMODP00000004814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]