SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004881 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004881
Domain Number 1 Region: 150-417
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.65e-37
Family Eukaryotic proteases 0.00032
Further Details:      
 
Domain Number 2 Region: 56-117
Classification Level Classification E-value
Superfamily GLA-domain 2.35e-24
Family GLA-domain 0.00034
Further Details:      
 
Domain Number 3 Region: 106-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000242
Family EGF-type module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004881   Gene: ENSMODG00000003968   Transcript: ENSMODT00000004985
Sequence length 417
Comment pep:novel chromosome:BROADO5:7:77793419:77834590:-1 gene:ENSMODG00000003968 transcript:ENSMODT00000004985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLDSSEAAWTIRMVGCFWMLQLCFLAFSLHQSEQSVFWPASKANEVMVRAKRARSFVLE
EILKGNLERECFEEKCAYEEAREVFENNEMTHSFWSQYMDGTPCISQPCLNNGMCQDNIR
NYICSCLEGYEGTNCEYAKNQCHSKRSEGCDHFCRPGQEFYICSCAKGYTLGKDHKSCIP
NEKCACGILSSENNVTLKDAKWTFPWQVKLTNSEGKEFCGGVIVQENFVLTTATCSLIYG
NISVKLSEDSIPGAPMEIKIKNKHVHVRYDQEMGQNNLALLELNEPIQCHSNGLPICIPE
KDFAEHMLIPEKISIVSGWTFNGTELGDSLTYLPSEYFNDEKCEEILNVTVTTRQFCEKS
KTSMDWQLVEGSIVMAEHKGTWFLIGIMAPPPSERPEPVFLFSKISRYSMWFEQVMK
Download sequence
Identical sequences F7FMG0
XP_007501312.1.35504 ENSMODP00000004881 ENSMODP00000004881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]