SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004898 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004898
Domain Number 1 Region: 571-861
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.93e-85
Family Protein kinases, catalytic subunit 0.0000000000723
Further Details:      
 
Domain Number 2 Region: 120-210
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-23
Family I set domains 0.047
Further Details:      
 
Domain Number 3 Region: 30-127
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-19
Family I set domains 0.025
Further Details:      
 
Domain Number 4 Region: 205-294
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000326
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004898   Gene: ENSMODG00000003983   Transcript: ENSMODT00000005002
Sequence length 874
Comment pep:novel chromosome:BROADO5:6:102997550:103201575:1 gene:ENSMODG00000003983 transcript:ENSMODT00000005002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKELAHIPVVHILALAAFSLAEKLPKAPIITTPLETVDALVEEVATFMCAVESYPQPEIA
WTRNKILIKLSDTRYSIRENGQLLTILSVEDSDDGVYCCTANNGVGVAAESCGALQVKMK
PKITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDTILRENTRIAILESGSLRIHNV
QREDAGHYRCVAKNSLGTAYSKLVMLEVEVFARILRAPESHNVTFGSIVTLRCTATGIPV
PTITWLENGNAVSAGSILESVKDRVIDSQLQLLITKPGLFTCIATNKHGEKFSTVKAAAT
ISISGYIFGTKYKLPQEDPGYCSTYRGEVCGAVLAKDALVFYNSSYQDSGDAQELLVQTI
WSDLKALSPLCQPAMESLLCNHIFQGCNPARFMPTPKPLCREHCLAVKDLFCAKEWLALE
EKAHKGLYKSGLHLFTLPECTKLPSMHREPMACTKVPHLEKYNKKTNNEFTPLVTVKPSA
DIPDWSSSSSTFSPTYSMTVIIAIISSFAVIGFLTMTALLCCRQRRRQWKNKKRESATPT
LTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAP
GLRPYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDHPNIVRLLGVCAVGKPMCLLF
EYMAYGDLNEYLRNMSPRTMCHLSHSNLATRVRLSSPGPPPLCCAEQLCIARQVAAGMAY
LSERKFVHRDLATRNCLVGNNMVVKIADFGLSRNIYSADYYKANENDAIPIRWMPPESIF
YNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIFYVRDGNILSCPENCPLELYNLM
RLCWSKLPTDRPSFTSIHRILQRMCERAEAAVGV
Download sequence
Identical sequences F7F8Z2
ENSMODP00000004898 ENSMODP00000004898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]