SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005258 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005258
Domain Number 1 Region: 339-625
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.19e-82
Family Protein kinases, catalytic subunit 0.0000000000504
Further Details:      
 
Domain Number 2 Region: 119-220
Classification Level Classification E-value
Superfamily Immunoglobulin 7.62e-21
Family I set domains 0.0000145
Further Details:      
 
Domain Number 3 Region: 29-101
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000114
Family I set domains 0.0000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005258   Gene: ENSMODG00000010647   Transcript: ENSMODT00000005371
Sequence length 693
Comment pep:novel chromosome:BROADO5:1:573129785:573143827:-1 gene:ENSMODG00000010647 transcript:ENSMODT00000005371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSSSEEKESDNTKPNPVAPYWTSPEKMENKLHAVPAAKTVKFKCPSNGTPNPSLRCLKNG
KEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVEITFSCFSFPFFSVERSPHRPI
LQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKHSGI
NSSDAEVLTLFNVTEAHSGEYVCKVSNYIGEARQSAWLTVTRPVAKALEERPAVMTSPVY
LEIIIYCTGAFLISCMVGSVIIYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTESRWGV
SADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCF
GQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLG
ACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHAPEEQLSSKDLVSCAYQVAR
GMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAP
EALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNEL
YMMMRDCWHAIPSQRPTFKQLVEDLDRIVALTSNQEYLDLSVPLDQYSPSFPDTRSSTCS
SGEDSVFSHDPLPEEPCLPRHPTQLANGGLKRR
Download sequence
Identical sequences F6TVE0
ENSMODP00000005258 13616.ENSMODP00000005258 ENSMODP00000005258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]