SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005260 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005260
Domain Number 1 Region: 819-1107
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-82
Family Protein kinases, catalytic subunit 0.0000000000395
Further Details:      
 
Domain Number 2 Region: 544-733
Classification Level Classification E-value
Superfamily Fibronectin type III 5.57e-24
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 3 Region: 370-448
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000166
Family I set domains 0.018
Further Details:      
 
Domain Number 4 Region: 441-538
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000829
Family Fibronectin type III 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005260
Domain Number - Region: 219-338
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00108
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number - Region: 131-218
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0622
Family I set domains 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005260   Gene: ENSMODG00000004269   Transcript: ENSMODT00000005373
Sequence length 1124
Comment pep:novel chromosome:BROADO5:6:43858372:43985014:1 gene:ENSMODG00000004269 transcript:ENSMODT00000005373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSLARLVLYGVSLIISGKVKAAMDLILINSLPLVSDGETSLTCIATGWRPHELITIGRD
FEALMNQHQEPLEVTQDESREWAKKVVWKREKASKINGAYYCEGKVRGESIRIRTMKMRQ
QASFLPDTLTMTVNKGDYVNISFKKVLIKEEDAVIYKNGSFIHSVPKHEVPDMLEVNVMN
TQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAEKWGPECRSSCIACTNKGICHEDTGEC
VCPPGFMGKTCEKACEEHMFGRTCKERCSGPDGCKSFMFCLPDPYGCSCATGWKGLQCNE
ACQPDFYGPDCKIRCKCTNGGTCDRFRGCLCPPNRHGLQCEKEGPSRVTPQIEDLPDHME
VNSGKFNPICKASGHPLPDAEEMTLVKPDGTVLQPKSFVRNNRSEAEFSIHRILPPDSGV
WVCSVNTVAGMVEKSFNISVKVPPEPLNAPKVVEAGHNFVTVNISSEPYLGDGPIKSKKL
LYKSSKQYETWKHLRVTEEIVTLDALESRTEYELCVQLSRRGEGGEGHPGPVKRFTTASI
GLPPPRGLSLLPRSQTTLNLTWQPIFPTSEDDVYVEVERRSMQVQSETQIIKVLANQTSV
ILYNLHPREKYIVRARVNTKSPGEWSEYLVAWTLSDKLPPQPDGIKISNITDTSAIISWS
ILDGHSISSIIIRYKIQGKAEENHIEVKIKNATITQYHIKGLEPQTAYWVDIFAENNMGS
SNSQPSHELITLQKFTVPKDLGGEKMLLIAILGSAGMTCLTVLLAFLIMLQLKRANVQRR
MAQAFQNVREEPAVQFNSGTLALNRKAKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLK
ARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYL
AIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQF
IHRDLAARNILVGENYIAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSD
VWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPY
ERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
Download sequence
Identical sequences F6TEV1
13616.ENSMODP00000005260 XP_001374851.1.35504 ENSMODP00000005260 ENSMODP00000005260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]