SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005261 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005261
Domain Number 1 Region: 305-590
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-82
Family Protein kinases, catalytic subunit 0.000000000127
Further Details:      
 
Domain Number 2 Region: 95-198
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-22
Family I set domains 0.0000047
Further Details:      
 
Domain Number 3 Region: 7-89
Classification Level Classification E-value
Superfamily Immunoglobulin 3.75e-20
Family I set domains 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005261   Gene: ENSMODG00000004268   Transcript: ENSMODT00000005374
Sequence length 654
Comment pep:novel chromosome:BROADO5:5:233265777:233299344:-1 gene:ENSMODG00000004268 transcript:ENSMODT00000005374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKKLLAVPAANTVRFRCPAAGNPTPSIYWLKNGREFKGEHRIGGIKLRHQQWSLVMESV
VPSDRGNYTCVVENKYGSIQQTYTLDVLERSPHRPILQAGLPANQTVVVGSNVEFHCKVY
SDAQPHIQWLKHVEVNGSKYGPDGTPYVTVLKTAGVNTTDKELEILYLRNVTFEDAGEYT
CLAGNSIGFSHHSAWLMVLPAEAMVEEDDSGSVFAGLLSYGLGFCLFIVVVAVAVAICRL
KMPSKKAINTPTVQKVSKFPLKRQVSLESNSSMNSNTPLVRIARLSSSEGPMLANVSELE
LPADPKWELCRSRLTLGKPLGEGCFGQVVMAEAIGIDKDKPNKPVTVAVKMLKDDATDKD
LSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVLVEYASKGNLREYLRARRPPGMDYS
FDTCKLPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDSVMKIADFGL
ARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGI
PVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAVPSQRPTFKQLVEDLDRVLTVTSTD
EYLDLSVPFEQYSPTCQDSHSTCSSGDDSVFAHDLLPEEPCLPKAPKCNGALRT
Download sequence
Identical sequences F6TEU5
ENSMODP00000005261 ENSMODP00000005261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]