SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005271 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005271
Domain Number 1 Region: 131-224
Classification Level Classification E-value
Superfamily Immunoglobulin 1.8e-19
Family I set domains 0.0037
Further Details:      
 
Domain Number 2 Region: 34-127
Classification Level Classification E-value
Superfamily Immunoglobulin 5.19e-19
Family I set domains 0.0021
Further Details:      
 
Domain Number 3 Region: 226-318
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-18
Family I set domains 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005271
Domain Number - Region: 1-32
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0195
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005271   Gene: ENSMODG00000004280   Transcript: ENSMODT00000005385
Sequence length 321
Comment pep:novel chromosome:BROADO5:4:406250425:406255200:1 gene:ENSMODG00000004280 transcript:ENSMODT00000005385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRDTAGRFHCLYWIGSALSEPSEPLEVVATGYYDPPGLSAEPSQDVAWGHDVTLRCLSV
QGIDRFVLYRVEGVNGSPWRDPQSHPDFLIQAVAAPHEGNYSCYEFHSQHPYAWSLPSAP
LELRVTGTFLRPSLRAEPSSVVPQGTPVRLWCRGSPTAHLFTLRKAGPGGYADIYVVIPP
AVGMEAEFLLSSVTASDGGLYKCCYRSPSGGSEDSEPLQLAVTGRFGKPSLWALPSPEEA
SGHEVTLQCQSEQRHDRAVLYKDGGPVAFGVARRRETGSQTNFSLPAGSAARGGTYSCYS
FHSGSPYEWSAPSEPLALGLM
Download sequence
Identical sequences F6TE06
ENSMODP00000005270 ENSMODP00000005271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]