SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005308 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005308
Domain Number 1 Region: 120-213
Classification Level Classification E-value
Superfamily Immunoglobulin 3.04e-21
Family I set domains 0.0016
Further Details:      
 
Domain Number 2 Region: 211-309
Classification Level Classification E-value
Superfamily Immunoglobulin 1.88e-20
Family I set domains 0.0038
Further Details:      
 
Domain Number 3 Region: 312-404
Classification Level Classification E-value
Superfamily Immunoglobulin 2.31e-18
Family I set domains 0.0023
Further Details:      
 
Domain Number 4 Region: 25-118
Classification Level Classification E-value
Superfamily Immunoglobulin 1.89e-16
Family I set domains 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005308   Gene: ENSMODG00000004312   Transcript: ENSMODT00000005422
Sequence length 474
Comment pep:novel chromosome:BROADO5:4:406308823:406330332:-1 gene:ENSMODG00000004312 transcript:ENSMODT00000005422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPTVTALLCFGLCLGQGIRALAEPLPRPTLHADPGPLVPWETPVTLRCRGHPEATWYRL
KKGETTIEGNQGIGAEAQFNISYMSKYTAGRFHCLYWIGSASSEPSEPSEPLDLVVTGYY
SPPQLSAEPSQDLTWGHNVTLRCHSSWAFNRFVLYREGGANSSPWGVRQSQSDFLIPAVA
TPHEGKYSCFVFHSQHPHTWSLPSAPLELRVTGTFLRPSLRAEPSSVVPQGTPVRLWCRG
SPTAHLFTLRKAGPGGYADIYVVIPPDSGMEAEFLLSSVTASDGGLYKCCYRSPSGGSED
SEPLQLVVTGRFGKPSLWALPSPEEASGHEVTLQCQSEQRHDRAVLYKDGGPVAFGVARR
RETGSQTNFSLPAGSAARGGTYSCYSFHSGSPYEWSAPSEPLALGLMGKAGTLRPGTNAE
TLPSPDLSASPPSAPGAASQDYTVGNVIRLSLAGLVLLLLGVLLAEAWTSRRGP
Download sequence
Identical sequences F6X745
13616.ENSMODP00000005308 ENSMODP00000005308 ENSMODP00000005308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]