SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005313 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005313
Domain Number 1 Region: 117-209
Classification Level Classification E-value
Superfamily Immunoglobulin 1.48e-22
Family I set domains 0.0019
Further Details:      
 
Domain Number 2 Region: 26-115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000541
Family I set domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005313   Gene: ENSMODG00000028822   Transcript: ENSMODT00000005427
Sequence length 354
Comment pep:novel chromosome:BROADO5:4:406106969:406126637:-1 gene:ENSMODG00000028822 transcript:ENSMODT00000005427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPTVTALLCFGLCLGQGIRALAESLPRPTLHADPGPLVPKETPVTLRCRGHPEATWYRL
MKGITKIQGYQGIGAEAQFIISSMSKDTAGHLHCLYWIGYALSEPSEPLEVVATGYYSPP
QLSAEPSQHVAWGHNVTLRCRSPWAYNRFVLYREGGANSSQWGVRQSQSDFLIPAVAAHH
EGNYSCFVFHSQHPHTWSLPSAPLELRVTVPVTSGPRLELPDVLFGLPRLQTGIWLGISA
LLILFFLLFLLFLLLRYHRKHQARQWTGGKEAGVEESLRRYSQDEDVPPESPYATMENIQ
IEEHGQVNTQVEDPQEVTYAHLIHHTPNQDLEYISPFPSEESTLYAPLAIQEVS
Download sequence
Identical sequences F6X704
XP_007492536.1.35504 ENSMODP00000005313 ENSMODP00000005313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]