SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005325 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005325
Domain Number 1 Region: 622-827
Classification Level Classification E-value
Superfamily Fibronectin type III 3.05e-33
Family Fibronectin type III 0.00046
Further Details:      
 
Domain Number 2 Region: 830-1015
Classification Level Classification E-value
Superfamily Fibronectin type III 4.55e-28
Family Fibronectin type III 0.00000445
Further Details:      
 
Domain Number 3 Region: 442-529
Classification Level Classification E-value
Superfamily Immunoglobulin 2.33e-19
Family I set domains 0.022
Further Details:      
 
Domain Number 4 Region: 337-429
Classification Level Classification E-value
Superfamily Immunoglobulin 3.59e-19
Family I set domains 0.00033
Further Details:      
 
Domain Number 5 Region: 251-337
Classification Level Classification E-value
Superfamily Immunoglobulin 6.97e-19
Family I set domains 0.0024
Further Details:      
 
Domain Number 6 Region: 524-627
Classification Level Classification E-value
Superfamily Immunoglobulin 3.08e-18
Family I set domains 0.098
Further Details:      
 
Domain Number 7 Region: 49-139
Classification Level Classification E-value
Superfamily Immunoglobulin 5.61e-16
Family I set domains 0.00022
Further Details:      
 
Domain Number 8 Region: 149-230
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000441
Family I set domains 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005325   Gene: ENSMODG00000003991   Transcript: ENSMODT00000005439
Sequence length 1054
Comment pep:novel chromosome:BROADO5:6:228658374:229120665:-1 gene:ENSMODG00000003991 transcript:ENSMODT00000005439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYLKTKYSIYQTQDKSYSCHWQLKMMLSWKQLILLSFIGSLRGDVSLQGPVFIREPSNN
IFPVGSEEKKITLNCEAKGNPSPHYRWQLNGSDIDLSMDYRYKLIGGNLVVINPSRNRDI
GTYQCFATNSLGTVVSKEAKLQFAYLEHFKTKMRSTVSVREGQGVVLLCGPPPHSGELSY
AWIFNEYPSFVQEDSRRFVSQETGHLYIAKVEPSDVGNYTCVVTSTVTNNRVLGSPTPLV
LRTDGVMGEYEPKIEVQFPETLPAAKGSTVKLECFALGNPVPQINWRRSDGLPFSSKIKM
RKSNGMLEIPNFQQEDTGLYECIAENSRGKNIARGRLTYYAKPHWVQMIKDIEAAVEDNL
YWECRASGKPKPSYRWLKNGDGLIVEERVQIDNGALSIAVLNVNDSGMYQCIAENKHGLI
YSSAELKVVASAPDFSKNPMKKLIQVQIGSLVIFDCKPKASPKAHCSWKKGDEILQSSER
TAILKDGGLQIANVTKLDVGTYTCIAENQFGKASSSTKLVVTEPTRITLAPSNMDVSVGE
SVILPCQVQHDPLLDIVFTWYFNGAITDFKKDGSHFEKVGGSSSGDLMIRNIQLKHSGKY
VCMVQTEVDSVSSAADLIVRGSPGPPESVKVDEITDTTAQLSWKEGTDNHSPITSYVIQA
RTPFSVGWQIVTTVPDTIDGKTFTATVVDLNPWVEYEFRVVANNKIGGGEPSLPSEKVRT
EEAVPEVPPSEVSGGGGSRSELVITWDPVPEELQNGEGFGYVVAFRPLGVTTWIQTVVTS
PDTPRYVFRNESILSFSPYEVKVGVYNNKGEGPFSPVTTVFSAEEEPTVAPSHVLANSLS
SSIIEVSWDAIPWKMSSGRLLGYEIRYWNNGGKEDSSNRVKVMGNETTARLQGLQSNLVY
YTAVRAYNSAGTGPFSATVNATTKKMPPSQPPGNVVWNATESKVLINWEQVKAMDNESEV
TGYKVFYRTSSQNNMNILNTNKTSAELLLPVNEDYIIEVKASTDGGDGTSSEQIRIPRIT
NMDARGSGSAVWNAYPFLSSCITTLPIILVKTLW
Download sequence
Identical sequences F6X6W5
XP_001373638.3.35504 ENSMODP00000005325 ENSMODP00000005325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]