SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005335 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005335
Domain Number 1 Region: 595-801
Classification Level Classification E-value
Superfamily Fibronectin type III 1.17e-33
Family Fibronectin type III 0.00041
Further Details:      
 
Domain Number 2 Region: 803-989
Classification Level Classification E-value
Superfamily Fibronectin type III 1.04e-26
Family Fibronectin type III 0.0000254
Further Details:      
 
Domain Number 3 Region: 417-502
Classification Level Classification E-value
Superfamily Immunoglobulin 3.72e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 309-402
Classification Level Classification E-value
Superfamily Immunoglobulin 1.86e-21
Family I set domains 0.00059
Further Details:      
 
Domain Number 5 Region: 224-310
Classification Level Classification E-value
Superfamily Immunoglobulin 2.09e-19
Family I set domains 0.0025
Further Details:      
 
Domain Number 6 Region: 499-601
Classification Level Classification E-value
Superfamily Immunoglobulin 1.41e-17
Family I set domains 0.082
Further Details:      
 
Domain Number 7 Region: 24-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000011
Family I set domains 0.00031
Further Details:      
 
Domain Number 8 Region: 124-203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000501
Family I set domains 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005335   Gene: ENSMODG00000004323   Transcript: ENSMODT00000005449
Sequence length 1027
Comment pep:novel chromosome:BROADO5:6:233743121:234376087:1 gene:ENSMODG00000004323 transcript:ENSMODT00000005449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLWELLVLQSFMLCLADDNTLHGPIFIREPSHVMFPLDSEEKKVKLNCEVKGNPKPLI
RWKLNGTDVDIGMDFRYSVVEGSLLINNPNKTQDAGTYQCIATNSFGTIVSKEAKLQFAY
LENFKTRTRSTVSVRQGQGMVLLCGPPPHSGELSYAWIFNEYPSYQDNRRFVSQETGNLY
IAKVEKSDVGNYTCVVTNTVTNHKVLGPPTPLILRNDGVMGEYEPKIEVQFPETVPTAKG
ATVKLECFALGNPVPTIIWRRADGKQIARKARRHKSNGILEIPNFQQEDAGLYECVAENS
RGKNVARGQLTFYAQPNWNQKINDIHVAIEESIFWECKANGRPKPTYRWLKNGEPLLTQD
RIQIEHGTLNITTVNLSDAGMYQCVAENRHGIIFASAELSVIALGPDFSRTLLKRMTLVK
VGGEVVIECKPKASPRPAYTWKKGKEIVRENERITFSEDGSLRIMNVTKSDAGSYTCIAT
NHFGTASSTGNLIVKDATRLLVPPSSMDVTVGESIVLPCQVSHDHSLDIVFTWSFNGHLI
DFDKDGDHFERVGGQDSAGDLMIRSIQLKHAGKYVCMVQTSVDKISATADLIVRGPPGPP
EAVTIDEITDTTAQLSWRPGADNHSPITMYVIQARTPFSVGWQAVNTVPELIDGRTFTAT
VVGLNPWVEYEFRVVAANTIGIGEPSRPSEKRRTEEALPEVTPANVSGGGGSKSELVITW
ETVPEELQNGGGFGYVVAFRPFGKVSWMQTVLASADASKYVFRNESLPPFSPYEVKVGVY
NNKGEGSFSPVTVVYSAEEEPTKPPPSIFARSLSATDIEVFWSSPLETLSKGRIQGYEVK
YWSHDDKEENARKIRTIGNQTSTKITNLKGSALYHLAVKAYNTAGTGPYSVTVNVTTKKP
PPSQPPGNIIWNSSDSKIILNWDQVKALDNESEVKGYKVLYRWNRQSSTSVIETNKTSVE
LSLPFDEDYIIEIRPFSDGGDGSSSEQIRIPKISSAYARGSGASTSNACTLSAISTIMIS
LTARSSL
Download sequence
Identical sequences F6X6D9
ENSMODP00000005335 ENSMODP00000005335 XP_007500172.1.35504 XP_007500173.1.35504 XP_007500174.1.35504 XP_007500175.1.35504 XP_007500176.1.35504 XP_007500177.1.35504 XP_007500178.1.35504 XP_016279938.1.35504 XP_016279939.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]