SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005354 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005354
Domain Number 1 Region: 212-310
Classification Level Classification E-value
Superfamily Immunoglobulin 1.33e-20
Family I set domains 0.0018
Further Details:      
 
Domain Number 2 Region: 312-409
Classification Level Classification E-value
Superfamily Immunoglobulin 3.93e-20
Family I set domains 0.025
Further Details:      
 
Domain Number 3 Region: 109-210
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000032
Family I set domains 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005354   Gene: ENSMODG00000004349   Transcript: ENSMODT00000005470
Sequence length 459
Comment pep:novel chromosome:BROADO5:4:406436062:406442196:1 gene:ENSMODG00000004349 transcript:ENSMODT00000005470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGALIQAHPTGCWEERALCKWSPPALGACWPAGGGKRAWPSGGSEERGRWEGRRPDLSSP
PIRLGPGSLAASHERACRTGQRGLPPLGSSGQGSASSRLPACLPSFIGVFPKPLIAASPQ
APVAPGTAVAIGCRGPIVPATLSGGYTFALLEAENLELLQRRSPAGTTANFSLPAARALD
TGSYRCVYYKKTAPHRGSAPSQALELTVLGPWPKPSLWAQPGLVVVPGTDVTLWCSRPKL
LSPQEKNFTLWKAGRQQPLQNRSSAQAWTGFLLSSVGLEDAGSYRCAYGEPRGSARDSEP
SDALELMVTGSLPKPSLSALPSLVVEPGTHLTLQCRQPLQSPLWGVTFALLKAGTPQPLQ
SQSPAGTSAVFPLLSVRAQDAGNYSCIYHGKEGSQVSEPSEVLEIWVTDSIEKDYTMENL
IQIGLATLILIILGFILGDACNDWRRSEDKSSKRDPRLE
Download sequence
Identical sequences F6X5D9
ENSMODP00000005354 ENSMODP00000005354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]