SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005359 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005359
Domain Number 1 Region: 102-193
Classification Level Classification E-value
Superfamily Fibronectin type III 7.1e-16
Family Fibronectin type III 0.0062
Further Details:      
 
Domain Number 2 Region: 206-299
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000855
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 3 Region: 8-71
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000873
Family Fibronectin type III 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005359   Gene: ENSMODG00000004351   Transcript: ENSMODT00000005475
Sequence length 389
Comment pep:novel chromosome:BROADO5:6:234384929:234422411:-1 gene:ENSMODG00000004351 transcript:ENSMODT00000005475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSAVLLLPPVNFTLLVTGLSEVLLRWRPNPNQDPKINSLKYKVRINTPNEDDYETKKTQS
TSVNVLHRGFSASVQTILHCGSNFFQSSWVSAELQTPPGAPGTSAVNLTCVTNILQDNVS
LFCTWFVGKNAPEDTQYFLFYRFNKHTEECQEYRRDLWKRNIACWFPETTIDRKGRGQLA
VRINGSSKQIAIKPLDQLFELHAIDQVNPPVNVTAKMEGNHLFIQWEKPVSNFPRKCFDY
EVNIYNIRKDYSWTQRIQENSFSLIVDPTCKYSLQIRATVHSSCRKSGLWSEWSQSIYVG
KMESTHLTEWLLAVVLMATACFLLLSFFFICRIFQVWTKLFPPIPVPNSKIKDLFLSNVH
EKTRSGETEIEVISYVEDCGLDNLDDSVF
Download sequence
Identical sequences F6WQJ6
13616.ENSMODP00000005359 ENSMODP00000005359 ENSMODP00000005359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]