SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005365 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005365
Domain Number 1 Region: 24-118
Classification Level Classification E-value
Superfamily Immunoglobulin 6.28e-22
Family I set domains 0.0015
Further Details:      
 
Domain Number 2 Region: 121-213
Classification Level Classification E-value
Superfamily Immunoglobulin 1.85e-16
Family I set domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005365   Gene: ENSMODG00000004357   Transcript: ENSMODT00000005482
Sequence length 376
Comment pep:novel chromosome:BROADO5:4:408032169:408038933:-1 gene:ENSMODG00000004357 transcript:ENSMODT00000005482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPALSVLLCLGEGQGPRQQVNGFHKPSLRAEKGSLVAQGGAVTLRCRGSWEAVEWRLEK
RGRSGWSLITAVRQAGNEGEFSLPSVTLHDAGTYRCFYRHSSSWWSQLSDPLQLVVTGLS
APPSLAALPGSEVAPGQNVTLQCRSELWYDWCVLCKDREEISRGRTRSHGWMYQTDFFFP
AVNPTQDGTYRCFGFYSSSPSLGASPSAPLVLRGSGTAKGPHLPQIPGNPPAVTSSPPRT
SPSPRSENGPSGHSILQVSILVGISAFLILTFLFLSLLYFHRCRYQPSLEKGERETDIKT
TRSSELAGSTLEETVYAAVNDDRRTEEAGQEDTSAFQREAPQEVTYAQLDHKRLKRGAEP
PPQSGPVEPSVYAALP
Download sequence
Identical sequences F6WPW3
ENSMODP00000005365 ENSMODP00000005365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]