SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005439 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005439
Domain Number 1 Region: 22-112
Classification Level Classification E-value
Superfamily Immunoglobulin 2.34e-20
Family I set domains 0.024
Further Details:      
 
Domain Number 2 Region: 142-232
Classification Level Classification E-value
Superfamily Immunoglobulin 3.03e-20
Family I set domains 0.0053
Further Details:      
 
Domain Number 3 Region: 238-356
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-16
Family I set domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005439   Gene: ENSMODG00000004433   Transcript: ENSMODT00000005556
Sequence length 494
Comment pep:novel chromosome:BROADO5:5:236693571:236815507:-1 gene:ENSMODG00000004433 transcript:ENSMODT00000005556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFWFAFFFLGIFSVSDSARGPPRISDRVAPRQSARLGRTVKLLCPVEGDPPPLTMWTKD
GRTIHSGWARFRVLPQGLKIKEVERGDAGTYVCKATNGFGSLSVNYTLIVMDDVTVSKEN
PGPEGPNGEQEDTSGKQWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRPDIMWLK
DDKTLTPQEVGENKKKKWTLNLKNLKPEDSGKYTCRVFNRAGEINATYKVEVIQRTRSKP
ILTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGTEGKYNSTIDVGGQKFVVL
PTGDVWSRPDGSYLNKLMITRARQEDAGMYICLGANTMGYSFRSAFLTVLPDPKPPSGPA
APSSASSLPWPVVIGIPAGAVFILGTVLLWLCQTKKKPCSPPPAAPGHRPPPRDRAGLAG
VPDKDCLTAGHYEDYGVGAQPPLPPPAQQHLLGQGPGPTAKLYPKLYTDIHTHTHTHSHS
HVEGKVHQHIHYQC
Download sequence
Identical sequences F6SV06
ENSMODP00000005439 XP_007496936.1.35504 ENSMODP00000005439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]