SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005508 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005508
Domain Number 1 Region: 119-239
Classification Level Classification E-value
Superfamily Fibronectin type III 2.08e-32
Family Fibronectin type III 0.0000122
Further Details:      
 
Domain Number 2 Region: 40-142
Classification Level Classification E-value
Superfamily Fibronectin type III 1.01e-23
Family Fibronectin type III 0.0000543
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005508   Gene: ENSMODG00000004472   Transcript: ENSMODT00000005626
Sequence length 291
Comment pep:novel chromosome:BROADO5:2:459546393:459562620:-1 gene:ENSMODG00000004472 transcript:ENSMODT00000005626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPNPCLLVAATASFRTVLLGFVFVQVSLASGTSDIVLPYNITWKSIDFKTILEWEPKP
VNNVYSVEISTRWGDWKRKCFQIKNTECDVTDEMKNVKDTYIARIISENQEKLEGDPEES
LHANAPNFIPYLDTNLGQPRIESFLQNGTKLRVKVQDSMTSFRYNGTFQTLRQIFHKDLT
YTLFYWRASSTGKKSEKTDTNEFLVDVDKGESYCFSVQAFIPSRRTKQKSPESKIICTSE
EKVVFKELFFIVGAILFVIIILVITLSVTLYKCSKSRAKRNRKENSPLNGV
Download sequence
Identical sequences F6VRP5
XP_001381814.1.35504 ENSMODP00000005508 ENSMODP00000005508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]