SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005537 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005537
Domain Number 1 Region: 784-899
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-34
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 2 Region: 241-343
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-33
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 3 Region: 621-725
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 4 Region: 1833-1942
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 5 Region: 2000-2120
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-31
Family Spermadhesin, CUB domain 0.00071
Further Details:      
 
Domain Number 6 Region: 2171-2290
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-31
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 7 Region: 1483-1589
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-31
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 8 Region: 65-171
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-29
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 9 Region: 1303-1419
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-28
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 10 Region: 444-554
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 11 Region: 963-1072
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 12 Region: 1136-1245
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 13 Region: 1649-1765
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-24
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 14 Region: 3003-3074
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.42e-21
Family Complement control module/SCR domain 0.00061
Further Details:      
 
Domain Number 15 Region: 2648-2716
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.34e-19
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 16 Region: 2944-3014
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 17 Region: 2705-2773
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.97e-18
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 18 Region: 2887-2955
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.26e-17
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 19 Region: 2764-2830
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.34e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 20 Region: 3063-3132
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.37e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 381-452
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 22 Region: 2462-2529
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 23 Region: 2819-2880
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000347
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 24 Region: 2118-2187
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000553
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 25 Region: 2589-2646
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000959
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 26 Region: 3182-3250
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000111
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 27 Region: 2400-2473
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 28 Region: 905-965
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000351
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 29 Region: 1423-1487
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000418
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 30 Region: 1946-2007
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000472
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 31 Region: 1594-1659
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000945
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 32 Region: 559-618
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000264
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 33 Region: 1078-1140
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000378
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 34 Region: 1772-1838
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000445
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 35 Region: 177-238
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000486
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 36 Region: 1249-1311
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000115
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 37 Region: 2536-2600
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 38 Region: 3241-3299
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000025
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 39 Region: 730-796
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000391
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 40 Region: 3122-3177
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000445
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 41 Region: 2289-2349
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000027
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 42 Region: 2346-2401
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000864
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005537   Gene: ENSMODG00000004489   Transcript: ENSMODT00000005655
Sequence length 3516
Comment pep:novel chromosome:BROADO5:3:382566197:384232901:-1 gene:ENSMODG00000004489 transcript:ENSMODT00000005655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGICKGEIRAKESKSGDFGKRGCIKCSRLDFILVKKMGIKSGFTFWNLVFLLMISCVKG
FIYTCGGTLKGLNGTIESPGFPYGYPNGANCTWVIIAEERNRIQIVFQSFALEEEYDYLS
LYDGHPHPTNFRTRLTGFHLPPPVTSTKSVFSLRLTSDFAVSAHGFKVYYEELQSSSCGN
PGVPPKGVLYGTRFDVGDKIRYSCVTGYILDGHPQLTCIANSVNTASWDFPVPICRAEDA
CGGTMRGSSGIISSPSFPNEYHNNADCTWTIVAEPGDTISLIFTDFQMEEKYDYLEIEGS
EPPTIWLSGMNIPPPIISNKNWLRLHFVTDSNHRYRGFSAPYQVKKAIDFKSRGFKLFPG
KDNSNKFSILNEGGIKTASNLCPDPGEPENGKRVGSDFSLGATVQFSCDEDYVLQGSKSI
TCQRIAEVFAAWSDHRPVCKVKTCGSNLQGPSGTFTSPNFPFQYDSNAQCVWVITAVNTN
KVIQINFEEFDLEIGYDTLTIGDGGEVGDPRTVLQVLTGSFVPDLIVSMSSQMWLHLQTD
ESVGSVGFKVNYKEIEKESCGDPGTPLYGIREGDGFSNRDILRFECQFGFELIGEKSIIC
QENNQWSANIPICIFPCLSNFTAPMGTVLSPDYPEGYGNNLNCIWTIISDPGSRIHLSFN
DFDLESQFDFLAVKDGDSPDSPILGTFTGAEVPSHLTSNSHILRLEFQADHSMSGRGFNI
TYNTFGHNECPDPGIPINARRFGDNFQLGSSISVICEEGFIKTQGTETITCILMDGKVMW
SGPIPRCGAPCGGHFSSPSGVILSPGWPGYYKDSLNCEWVIEAEPGHSIKITFERFQTEL
NYDVLEVHDGPNLLSPLLGSYNGTQVPQFLFSSSNFIYLLFTTDNSRSNNGFKIHYESVT
VNTYSCLDPGIPVHGRRYGHDFSIGSTVSFSCDPGYRLSHEEPLLCEKNHWWSHPLPTCD
ALCGGDVRGPSGTILSPGYPEFYPNSLNCTWTVDVTHGKGVQFTFHTFHLEDHHDYLLIT
ENGSFTQPLARLTGSELPSIINAGLYGNFRAQLRFISDFSISYEGFNITFSEYNLEPCED
PGIPQYGSRIGLNFGVGDTLTFSCSSGYRLEGTSEIICLGGGRRVWSAPLPRCVAECGAS
ATNNEGILLSPNYPLNYENNHECIYSIQVQAGKGINISARTFHLAQGDVLKIYDGKDKTT
HLLGAFTGASMRGLTLSSTSNQLWLEFNSDSEGTDEGFQLVYTSFELSHCEDPGVPQFGY
KISDQGHFAGSTIIYGCNPGYTLHGSSLLKCMTGERRAWDYPLPSCIAECGGRFKGESSG
RILSPGYPFPYDNNLRCMWMIEVDPGNIVSLQFLAFDTEASHDILRVWDGPPENEMLLKE
ISGSLIPEGIHSTLNIVTIQFDTDFYISKSGFAIQFSSSVATACRDPGVPMNGTRNGDGR
EPGDTVIFQCDPGYELQGEERITCIQVENRYFWQPSPPVCIAPCGGNLTGSSGFILSPNF
PHPYPHSRDCDWTITVNSDYVISLAFISIEPNYDFLYIYDGPDSNSPLIGSFQDSKLPER
IESGSNTMHLAFRSDGSVSYTGFHLEYKAKLRESCFDPGNIMNGTRLGMDYKLGSTVTYY
CDAGYVLQGYSTLTCIMGDDGRPGWNRALPSCHAPCGSRSTGSEGTVLSPNYPKNYSVGH
NCVYSIAVPKEFVVFGQFVFFQTSLHDVVEVYDGPTQQSALLSSLSGSHSVGESLPLSSG
NQITIRFTSVGPITAKGFHFVYQAVPRTSATQCSSVPEPRFGRRIGNEFAVGSLVLFECN
PGYILYGSIAIRCDTVPNSLAQWNDSLPTCVVPCGGILTKRKGTILSPGYPEPYDNNLNC
VWKITVPEGAGIQVQVVSFATEHNWDSLDFYDGGDNNAPRLGSYSGTTIPHLLNSTSNNL
YLNFQSDISVSAAGFHLEYTAIGLDSCPEPQTPSSGIKIGDRYMVGDVVSFQCDQGYSLQ
GHSHITCMPGPVRRWNYPIPICLAQCGGSMSDFSGVILSPGFPGNYPSSLDCTWTIKLPI
GFGVHLQFVNFSTETIHDYLEVRSGSSETSTVIGRLSGPQIPSSLFSTTHETSLYFHSDY
SQNKQGFHIIYQAYQLQSCPDPRPFRNGFVIGNDFTVGQTISFECFPGYTLIGNSALTCL
HGVSRNWNYPLPRCEALCGGNITAMNGTIYSPGYPDEYPNFQDCFWLVRVPPGNGIYINF
TVLQTEPIYDFITVWDGPDQNSPQIGQFSGNTALESVYSTSNQILIKFHSDFTTSGFFVL
SYHAYQLRVCQPPPPIPNAEILTEDDEFEIGDIIRYQCLPGFTLVGNEILTCRLGERLQM
DGAPPVCQGPNIQSPVLISLSGDYSSALNISSNGHEVFLQWSADHGNNKKGFRIRYIALY
CSTPESPPHGYIISQTGGQLNSVVRWACDRGFRLVGKSSAVCRKSPYGYHAWDAPVPACQ
AISCGIPKAPTNGGILTTDYLVGTRVTYFCNDGYRLSSKELTTAVCQSDGTWSNHNKTPR
CVVVTCPSINSFSLEHGRWRIVNGSHYEYKTKVVFSCDPGYHGLGPASIECLANGTWSWR
NERPYCQIISCGELPTPPNGNKIGTQISYGSTAIFTCDSGYMLVGSTVRECLSSGLWSGT
ETRCLAGHCGIPELIVNGQVIGENYGYRDTVVYQCNPGFRLIGSSVRICQQDHNWSGQLP
SCVPVSCGHPGSPIYGRTSGNGFNFNDVVTFSCNIGYIMQGPTKAQCQANRQWSHPPPVC
KVVNCSDPGIPANSKRESKIEHGNFTYGTVVFYDCNPGYFLFGSSVLICQPNGHWDKPLP
ECIMIDCGHPGVPPNAILSGEKYTFGSTVHYSCTGKRTLLGQSARTCQLNGHWSGSQPHC
SGDVTGSCGDPGIPGHGSRQESNFRTKSIVRFSCETGYILHGSEERTCLANGSWTGRQPE
CKAVQCGNPGTTANGKVFRIDGTTFSSSVIYSCMEGYILSGSSVRQCTANGTWSGSLPNC
TIISCGDPGIPANGMRYGDEYVVGQNVTYMCQPGYTMELNGSRIRTCTTNGTWSGTMPTC
KAVTCTTPPQISNGRLEGTNFDWGFSISYICSPGYELSFPAVLTCVGNGTWSGEVPQCLP
KFCGDPGIPAQGKREGKSFIYQSEVSFSCSPFVLVGSSTRICQADGLWSGSSPHCIEPTR
TSCENPGVPRHGSQNNTFGFQVGNIVQFHCKKGHLLQGSTTRTCLPDLTWSGIQPECIPH
SCKQPETPAHANVVGMDLPSHGYTLIYTCQPGFFLAGGTEHRVCRSDSTWTGKVPVCEVP
DDVFAQNYIWKGSFNFKGRKQPMTLTVTSFNSSTGRVNATLSNSNMELLLSGVYKSQEAR
LMLHIYLIKTPAHASVSKMKEENWAMDGFVSAEPDGATYVFQGFIQGKDYGQFGLQRLGL
NMSEGSNSSNQPHGTNSSSVAIAILVPFFALIFAGFGFYLYKQRTAPKTQYTGCSVHENN
NGQAAFENPMYDTNAKSVEGKAVRFDPNLNTVCTMV
Download sequence
Identical sequences F6VR22
ENSMODP00000005537 ENSMODP00000005537 13616.ENSMODP00000005537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]