SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005552 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005552
Domain Number 1 Region: 718-922
Classification Level Classification E-value
Superfamily Fibronectin type III 1.28e-35
Family Fibronectin type III 0.00000777
Further Details:      
 
Domain Number 2 Region: 305-397
Classification Level Classification E-value
Superfamily Immunoglobulin 7.36e-20
Family I set domains 0.0092
Further Details:      
 
Domain Number 3 Region: 404-518
Classification Level Classification E-value
Superfamily Immunoglobulin 7.47e-20
Family I set domains 0.031
Further Details:      
 
Domain Number 4 Region: 223-310
Classification Level Classification E-value
Superfamily Immunoglobulin 4.75e-16
Family I set domains 0.0093
Further Details:      
 
Domain Number 5 Region: 29-115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000272
Family I set domains 0.028
Further Details:      
 
Domain Number 6 Region: 569-672
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000563
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 7 Region: 132-199
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000184
Family I set domains 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005552
Domain Number - Region: 1090-1125
Classification Level Classification E-value
Superfamily Insect cysteine-rich antifreeze protein 0.0981
Family Insect cysteine-rich antifreeze protein 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005552   Gene: ENSMODG00000004499   Transcript: ENSMODT00000005670
Sequence length 1255
Comment pep:novel chromosome:BROADO5:4:274135932:274237151:-1 gene:ENSMODG00000004499 transcript:ENSMODT00000005670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPDFGSLQILLCISFMILCSSVSSDLVPRFVSEPHSVVQKLGEPVTLQCSAQPVTAHIS
WLLNGKKFNKNVEQIEVQQGTLTILSLSPSLSGQYQCIANNSIGAIVSKPATVSIGGLGD
FGTSVKHVIIAEEQSAGFVGCKIPESNPSAQVRYKVRGKWLERSTDNYLILPSGNLQILN
VSSEDKGSYKCAAYNPVTHELKVEPTGHKLIVSYPSSKYVQIIHPTFSQSLTALSHKPVT
LECVVSGVPASHVQWIKDGHSSLLGSNWKQLHSHLVTDSIKPTDAGNYSCVVGNKSGELT
RVTYTVNVLEQASISKGLKDQIVSLGATVHFTCTVYGNPTPNLTWFHNAEPIQPSLRHLT
IENTLRISDIAMEDSGLYQCVVDNGIGFMQSTGRLKIETGSGFKPIIITPPTSTKVVGGD
FVTLSCNATGLPVPVIRWYDNRGLITSHPSQVLCSKSRKSHLAKFRDVSLEPAYFIMSRA
GSSSLYIQAVTLAHAGKYTCEATNEHGSTLSEAFLTVVPFETSTKTETVTPVDATQSDKY
KKDDSAIGLLNMSPVKLHSNTTEASVERNTSNFSAPDAPIILSPPQTHKPDAYNLIWRSG
KDGGLPINAYFVKYRKLDDGVGLVGNWHTVRVPGSENELHLTELEPSSLYEVLMVARSAA
GEGQPAMLTFRTSKERTLSSKNTQASSPPVGIPKHPVVSEGTNSNFGVVLTDPSRHSGVP
EAPDRPTISTASETSVYVTWIPRANGGSPITAFKVEYKRMKNSDWLVAAEDIPPSKLSVE
VRSLEPGSTYKFRVIAINHYGESFRSSASRPYQVAGFPNRFSNRPVAGPHIAYTEAVSDT
QIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHMIGHLQPETSYD
IKMQCFNEGGESEFSNVMICETKVKRVPGASEYPAKDLSTPPNSFGSGGNVGSALSPARS
SNMLYLIVGCVLGVMVLILMVFIAMCLWKNRQQNTIQKYDPPGYLYQGSDINGPVMEYTT
LPGTSRINGSVHGNFISNGTLSNGCPHLHHKVPNGVNGIMNGNVNGGHYPGHNSLTRTHV
EYEHPHHLVNSGGMYTAVPQTDSLECINCRNCRNNNRCFTKTNGTFSNSSLPVIPMVAPY
QPDSLEMKPLNHVMVPMCLASTVPECGELPEEDIKNKMAPASTQHPCCQENTKQINSDCT
EGDSCLHSETENHVLSWSSLILPSLSRDCSEKTAWSSTDVTVDNTSKDFRQPQET
Download sequence
Identical sequences F6VA84
ENSMODP00000005552 XP_007495152.1.35504 XP_016289453.1.35504 XP_016289454.1.35504 XP_016289455.1.35504 ENSMODP00000005552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]