SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005615 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005615
Domain Number 1 Region: 205-275
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000015
Family C1 set domains (antibody constant domain-like) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005615   Gene: ENSMODG00000004557   Transcript: ENSMODT00000005734
Sequence length 483
Comment pep:novel chromosome:BROADO5:Un:65003579:65006694:1 gene:ENSMODG00000004557 transcript:ENSMODT00000005734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNVVQEALWEGTRPKGSGTGSSSAVVASTSMGRRLLPAWPLAVVLLASVPPSAWGCMIC
DPAVVAGLRDLEHNYLPSHLNMDTQALQALVKRLEETVRQFSDLPFDKNSYQGVVDEPTL
DKAAWAFLKELKRIQDSNIKDTYLLNELTWTMKMQKKNFARLVAEFQRENFCPNKCGTMM
QTLIWCLGCEKDVHTCRKSYTCGEQAVQVIEKGDLILDCELSWHKKAEGLTTYSFFKILT
NGTEVLLSRGKDSALTKPMVAFEDGGSYRCILDTIRKHSPATIIVYRVQVIPDGKKEPDT
TTDSGQRPNPTTTTPSSTSKISVHSTLVVGPRPIPTSTPRPTLTSTPRPTLTSTPKRTFQ
THKPHSTVKQEDVGTSTPWKKETPTYTRVTEAGSEVASRPWQEHGDGIANTSQNASSTLS
ITLIGLVAGGAIVVLGSLALTLYCARRAGLDLGRKKKQCTGNQCYWTTQSGPGKSENSLL
LGK
Download sequence
Identical sequences H9H653
ENSMODP00000005615 ENSMODP00000005615 XP_007506895.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]