SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005644 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005644
Domain Number 1 Region: 369-665
Classification Level Classification E-value
Superfamily Kelch motif 1.96e-48
Family Kelch motif 0.0034
Further Details:      
 
Domain Number 2 Region: 776-942
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-23
Family C-type lectin domain 0.0035
Further Details:      
 
Domain Number 3 Region: 150-264
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-22
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 4 Region: 1082-1128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000046
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005644
Domain Number - Region: 117-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000904
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 266-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0858
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005644   Gene: ENSMODG00000004575   Transcript: ENSMODT00000005763
Sequence length 1448
Comment pep:novel chromosome:BROADO5:5:237091307:237321526:1 gene:ENSMODG00000004575 transcript:ENSMODT00000005763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSAAAEGRQKRPEAAAAAEAAASSERTRRPLPQCRGPGWGRGRGRAAAAAVVTGRARSV
WLAPGPRSWPFLRPPSAPPLLLPLLLLLLPLPLPLPRAAEAAAAAAAMSGSAIAEAKECD
RPCVNGGRCNPGTGQCICPAGWVGDQCQHCGGRFRLTGSTGFVTDGPGNYKYKTKCTWLI
EGQPNRILRLRFNHFATECSWDHLYVYDGDSIYAPLVAAFSGLIVPERDGNVTVPEVVAT
SGYVLLHFFSDAAYNLTGFNITYSYDICPNNCSGRGECKFSNSSNTVKCECSKYWKGESC
DIPYCTNDCGYPDRGFCNSSDIRECSCFPNWQGPGCAIPVPANQSFWTREEYFQPKLPRA
SHKAVVNGNIMWIVGGYMFNHSDYNMVLAYDLDAGEWLPLNQTVNDVVVRYGHSLALYKD
KIYMYGGKIDSTGNVTNELRVFHIKNESWVLLAPKAKEQYAVVGHSAHIVTMKNGRVVML
VIFGHCPLYGYISNVQEYDIVTNTWSILHTQGALVQGGYGHSSVYDAKTNSLYIHGGYKA
FSANKYRLADDLYKYDVDTQMWTILKDSRFFRYLHTAVIISGTMLVFGGNTHNDTSMSHG
AKCFSSDFMAYDIACDRWSVLRRPDLHHDINRFGHSAVLYNSTMYVFGGFNSLLLSDILM
FTTERCEAYASEDSCVAAGPGVRCVWNMNSSECIPWESATEVQEEKTRAECFQKEVSADH
DKCDQHTDCYSCTANTNDCQWCNDHCISMNSNCTEGQVSISKYENCPKDNPMYYCNKKTS
CKSCAMDQNCQWEPRNQECVALPENICGPGWHLVGNSCLKITTAKDNYDNAKLSCRNMNA
LLASLTTQKKVEFVLKQLRLMQSAQTLSKTTLTPWVGLRKINVSYWCWEDMSPFTNSLLQ
WLPSEPSDAGFCGILAEPNARGLKAATCINPLNGSICERPANHSAKQCRTPCALRTMCGE
CTSGSSECMWCSNMKQCVDSNAYVASFPFGQCMEWYTMSSCPPENCSGYCTCGHCLEQPG
CGWCTDPSNTGKGKCIEGSYKGPVKMPFQAPTGSYYPQPLLNSSMCLEENRYNWSFIQCP
ACQCNGHSKCVNESICEKCENLTTGKHCETCISGFYGDPTNGGTCQPCKCNGHASLCNTN
TGKCFCTTKGIKGDECQLCEVENRYQGNPLKGTCYYTLLIDYQFTFSLSQEDDRYYTAIN
FVATPEEQNRDLDMFINASKNFNLNITWATSFAAGTQAGEEMPVVSKTNVKEYKDSFSNE
KFDFRSHPNITFFVYVSNFTWPIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVW
KIKQSCWASRRREQLLREMQQMASRPFASINVALETDEEPPDLIGGSIKAVPKPIALEPC
FGNRAAVLSVFVRLPRGLGGIPPPGQSGLAVASALVDISQQMPIAYKEKSGAMRNRKQQP
PAQPGTCI
Download sequence
Identical sequences F6R4A2
ENSMODP00000005644 ENSMODP00000005644 XP_016278856.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]