SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005761 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005761
Domain Number 1 Region: 113-217
Classification Level Classification E-value
Superfamily Immunoglobulin 8.52e-19
Family I set domains 0.086
Further Details:      
 
Domain Number 2 Region: 301-389
Classification Level Classification E-value
Superfamily Immunoglobulin 5.09e-17
Family I set domains 0.034
Further Details:      
 
Domain Number 3 Region: 386-482
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000543
Family I set domains 0.028
Further Details:      
 
Domain Number 4 Region: 17-118
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000319
Family I set domains 0.049
Further Details:      
 
Domain Number 5 Region: 213-298
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000433
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005761   Gene: ENSMODG00000004676   Transcript: ENSMODT00000005882
Sequence length 745
Comment pep:novel chromosome:BROADO5:4:274721684:274924239:-1 gene:ENSMODG00000004676 transcript:ENSMODT00000005882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKEKFRRMNEGQVYSFSQQPQDQVVVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDL
SRYPQYLVVGNHLSGEHHLKILRAELQDDAVYECQAIQAAIRSRPARITVLVPPDDPVIL
GGPVISLRAGDPLNLTCHADNAKPAASIIWMRKGEVMNGATYSKTLLRDGKRESIVSTLF
VSPADVENGQHIVCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPQPVLDGNTVKFHCSA
KANPAVTQYRWAKKGQVIKDESGDSYETTVDHTYFFEPVSCEVTNALGSTNISRTVDVYF
GPRMTSEPQSLLVDLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENTLTLKTVRQEDA
GKYVCRAVVPRVGAGEREVSLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAW
SWKENVLESGTSGRYTVETVSTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIR
LKEQGTEMKSGAGLEAESVPMSVIIGVAVGAGVAFLVLMATIVAFCCARSQRNLKGVVSA
KNDIRVEIVHKEPAAGRDSEEHPTIKQLMMDRGEFQQDSVLKQLEVLKEEEKEFQNLKDP
TNGYYSVNTFKEHHSTPTISLSSCQPDLRPAGKQRVPTGMSFTNIYSTLSGQSRLYDYGQ
RFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASS
SHHSQSSSQNSDPSRPLQRRMQTHV
Download sequence
Identical sequences F6U6K9
ENSMODP00000005761 ENSMODP00000005761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]