SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005801 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005801
Domain Number 1 Region: 23-215
Classification Level Classification E-value
Superfamily PR-1-like 1.83e-55
Family PR-1-like 0.00012
Further Details:      
 
Domain Number 2 Region: 284-382
Classification Level Classification E-value
Superfamily LCCL domain 1.57e-29
Family LCCL domain 0.0012
Further Details:      
 
Domain Number 3 Region: 386-491
Classification Level Classification E-value
Superfamily LCCL domain 8.63e-27
Family LCCL domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005801   Gene: ENSMODG00000004706   Transcript: ENSMODT00000005924
Sequence length 497
Comment pep:novel chromosome:BROADO5:1:688563000:688633634:1 gene:ENSMODG00000004706 transcript:ENSMODT00000005924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPTLACIVSLGLAFLICQTQAFFLPNATHLEKLLSKYQNDQPHSRSKRAIPRADREEIL
KLHNKLRGQVYPSASNMEYMTWDDELEKSATAWAQECIWEHGPATLLVSIGQNLAVHWGR
YRSPAFHVQSWYDEVKDYTYPYPHECDPWCPERCSGPMCTHYTQIVWATTNKVGCAVNTC
RRINVWGDVWENAVYLVCNYSPKGNWIGEAPYRNGSPCSECPPSYGGGCRNNLCYRDETY
AQKPETDETNEVEMSQIPEEKHVWVQPRVTKPTKTKKTTTDNYMTQIIKCETKMRDKCKG
STCNRYQCPAGCFNNKAKIFGTLFYESSSSICRAAIHFGVIDDKGGLVDITRNGRVPFFV
RSEKNGIASLSKYKASNSFMVSKVTVQDLDCYSTVAELCQFEKPAKHCPRIRCPAHCKNE
PSYWAPVYGTNIYADTSSICRTAVHAGAIKDETGGYVDVMPVDKKKIYVGSLRNGIQSES
LRTPRDGKAFRIFAVKQ
Download sequence
Identical sequences F6QH65
XP_001375095.2.35504 ENSMODP00000005801 ENSMODP00000005801 13616.ENSMODP00000005801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]