SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005844 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005844
Domain Number 1 Region: 479-756
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.57e-79
Family Protein kinases, catalytic subunit 0.000000000646
Further Details:      
 
Domain Number 2 Region: 192-394
Classification Level Classification E-value
Superfamily Fibronectin type III 3.22e-33
Family Fibronectin type III 0.00041
Further Details:      
 
Domain Number 3 Region: 775-843
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.24e-19
Family SAM (sterile alpha motif) domain 0.00025
Further Details:      
 
Domain Number 4 Region: 2-65
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.53e-19
Family Ephrin receptor ligand binding domain 0.0000598
Further Details:      
 
Domain Number 5 Region: 122-193,231-250
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000356
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005844   Gene: ENSMODG00000004739   Transcript: ENSMODT00000005967
Sequence length 857
Comment pep:novel chromosome:BROADO5:2:256964100:256978582:1 gene:ENSMODG00000004739 transcript:ENSMODT00000005967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENPYIKVDTVAAEHLSRKRQGSETTGKVNVKTLRLGPLTKAGFYLAFQDQGACMALLSL
HLFYKKCSKLTVNLTHFPETVPHELVVPVAGSCVADAVPASGPGPSLYCREDGQWADQPV
TGCTCAAGHEAVEDNTKCRACMQGTFKPLAGEGSCQLCPANSQSNSFGSTICQCRIGYFR
APTDPLGAPCTTPPSAPRSVVAHLNGSSLRLEWSAPLESGGRGDLTYALRCRECHPRGSC
VSCGKDMTFDPGPENLAEPWVGVQGLRPDLTYAFEVMAINGVSSVALGPVPVEAVNVTTD
REVPPPVSDIQVTGASPSSLSLTWPIPYSSNGAVLDYEVKYHEKGVEGPSGVRFLKTSEN
QAELQGLKRGTSYLVQVRARSEAGYGPFGREHDSQTKLDENETWREQLALISGTAAVGVI
LILVVIVIAVLCLRKQSSGRDAEYSDKHGQYLIGHGTKVYIDPFTYEDPNEAVREFAKEI
DVSYVKIEEVIGAGEFGEVCRGRLKTPGKKESYVAIKTLKGGYTERQRREFLSEASIMGQ
FEHPNIIRLEGVVTNSVPVMILTEFMENGALDSFLRLNDGQFTAIQLVGMLRGIASGMRY
LAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGGKIPIRWTAPE
AIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPSDCPTSLH
QLMLDCWQKDRNARPRFPQVVSALDKLIRNPASLKIVARENGGASHPLLDQRLPHFSAFG
SVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILSSIQHMRS
QAKPATPGGAGGPAPQY
Download sequence
Identical sequences F6XJC5
ENSMODP00000005844 ENSMODP00000005844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]