SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005907 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005907
Domain Number 1 Region: 27-121
Classification Level Classification E-value
Superfamily Immunoglobulin 8.67e-31
Family V set domains (antibody variable domain-like) 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005907   Gene: ENSMODG00000004797   Transcript: ENSMODT00000006031
Sequence length 123
Comment pep:novel chromosome:BROADO5:Un:80111746:80112227:1 gene:ENSMODG00000004797 transcript:ENSMODT00000006031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWPLVCLSLLTFCSVSLFAGSLSQDVVTQPPSASAALGSSARLSCTLSSASSSYYVYWH
QQSSGKAPRYLLYVTSSGGTGRGDGIPERFSGSRSGTNRFLSISNVQAEDEADYFCQAYY
YHS
Download sequence
Identical sequences H9H655
ENSMODP00000005907 ENSMODP00000005907 13616.ENSMODP00000005907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]