SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005925 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005925
Domain Number 1 Region: 8-170
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.8e-46
Family G proteins 0.000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005925   Gene: ENSMODG00000004814   Transcript: ENSMODT00000006049
Sequence length 203
Comment pep:novel chromosome:BROADO5:1:382889011:382892015:-1 gene:ENSMODG00000004814 transcript:ENSMODT00000006049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGQRVDLKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLG
IWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELQSLEEGCQIYLCGT
KSDLLEEDRRLRRVDFHDVQDYADDIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQL
MTEDKGVDLGQKGNTYFYSCCHH
Download sequence
Identical sequences F6V5H3
XP_016286026.1.35504 XP_016286028.1.35504 ENSMODP00000005925 ENSMODP00000005925 13616.ENSMODP00000005925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]