SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005959 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005959
Domain Number 1 Region: 175-490
Classification Level Classification E-value
Superfamily L domain-like 4.25e-56
Family Ngr ectodomain-like 0.014
Further Details:      
 
Domain Number 2 Region: 55-238
Classification Level Classification E-value
Superfamily RNI-like 5.57e-28
Family Cyclin A/CDK2-associated p19, Skp2 0.076
Further Details:      
 
Domain Number 3 Region: 611-709
Classification Level Classification E-value
Superfamily Immunoglobulin 5.49e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 698-793
Classification Level Classification E-value
Superfamily Immunoglobulin 3.4e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 506-617
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-17
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005959   Gene: ENSMODG00000004837   Transcript: ENSMODT00000006083
Sequence length 1121
Comment pep:novel chromosome:BROADO5:8:30203167:30264145:-1 gene:ENSMODG00000004837 transcript:ENSMODT00000006083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHSRLRAAAATTLGLRLLLLSLLGFVGSAAGQSSSSSQRSGGRPTTSASASPPCPSPCR
CLRDLLDCSRRRLTELPEPLPPWVVQLDLSHNRLSSIKASSLSQLQRLQEVKLNNNEFEA
IPNLGAAAANITLLSLANNKITEILPEHLKPFQSLETLDLSSNNISELKTTFPSLQLKYL
YINSNPIRSMEAGSFDNLANTLQVLKLNRNKISTIPPKMFKLPHLQHLELNRNKIKKVDG
LTFQGLGSLKSLKMQRNGINRLMDGAFWGLSNMEILQLDHNNLTEITKGWLYGLLMLQEL
HLSQNAIHRISSDAWEFCQKLSELDLTFNRLARLDDSSFIGLSLLNTLHIGNNKVSYIAD
CAFRGLSSLQTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFSGLDAL
EHLDLSNNAIMSLQGNAFSQMKKLQELHLNTSSLLCDCQLKWLPQWVAENNFQSSVNASC
AHPQQLKGRSIFAVSPDGFVCDDFPKPQITVQPETQSAIKGSNLSFICSAASSSDSPMTF
AWKKDNELLPDAEMENYAHLRAHGGEVMEYTTILRLRNVQFTTEGKYQCVISNHFGSSYS
VKAKLTVNMLPSFTKIPMDLTVRAGAMARLECAAVGHPAPQIAWQKDGGTDFPAARERRM
HVMPEDDVFFIVDVKIEDVGVYSCTAQNSAGSISANATLTVLETPSFLRPLLDRTVTKGE
TAVLQCIAGGSPPPKLNWTKDDSPLIVTERHFFAAGNQLLIIVDTDIEDAGKYTCEMSNT
LGTERGNVRLSVIPTPTCDSPQNAAPSLDDDGWATVGVVIIAVVCCVVGTSLVWVVIIYH
TRRRNEDCSITNTDETNLPADIPSYLSSQGTLAERQDGYGSSENGSHHQFITSSGGGYLL
QRDSSGTCHMDNSSETDMEGVTDPFLCHYLGTTGTVYLKSTVYGSDSFDTYRPGCSPDPR
TSCLDHYDSAYVKKKECYPCSHPSEESWDQNMSSVGMSSPITKLFNSIYIQNEGSGIKSL
SQDRNAVDFNAIPESTSTASNNAFMGTFGKPLGKPQLDAFSSCGQPKLLHMNPHDSQDFS
SELEEDGRERTVFPGENHTHAYKQVLEGYRTPTLQSYDLDT
Download sequence
Identical sequences F6UL26
ENSMODP00000005959 XP_001375215.1.35504 ENSMODP00000005959 13616.ENSMODP00000005959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]