SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006035 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006035
Domain Number 1 Region: 459-744
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-82
Family Protein kinases, catalytic subunit 0.000000000525
Further Details:      
 
Domain Number 2 Region: 144-243
Classification Level Classification E-value
Superfamily Immunoglobulin 3.51e-20
Family I set domains 0.0000564
Further Details:      
 
Domain Number 3 Region: 250-351
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-19
Family I set domains 0.0000366
Further Details:      
 
Domain Number 4 Region: 39-107
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000002
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006035   Gene: ENSMODG00000004899   Transcript: ENSMODT00000006163
Sequence length 805
Comment pep:novel chromosome:BROADO5:1:382601673:382616882:1 gene:ENSMODG00000004899 transcript:ENSMODT00000006163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLASVLGTLLAAAGFLVIHAFTSEEVEQEPCQAPGPEELEQHLTLALGQALRLCCGRA
NRGGHWYKEGTRLAPSGRVRAWRGRLEIATLVYEDAGLYLCVSRGSGHVLHNLTISVIDS
LASGDDDEDSDSSPKDLPKGHIYPQQGPYWTHPHRMEKKLHAVPAGNTVKFRCPAAGNPM
PTIRWLKNGEDFHGEHRIGGIRLRHQHWSLVMESVVPSDRGTYTCVIENALGSLRYNYLL
DVLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIEVNGSSFGADGF
PFVQVLKTADINSSEVEVLYLRNVSSEDAGEYTCLAGNSIGLSYQSAWLTVLPEERLVWE
AAASEVKATDIIMYTSGSVAILVILVIAGLCRGQALSSRPPHQPLAVQKLSRFPLIRQFS
LESGSSGKLSSSLVRGGRLSSSCTPMLPGLVELDLPLDAKWEFPRDRLVLGKPLGEGCFG
QVVWAEAYGMDPQQPDGAATVAIKMLKDNASDKDLADLISEMEMMKLIGRHKNIINLLGV
CTQEGPLYVIVEFAAKGNLREYLRARRPPSPDYTLEAPRTPEEQLSFQALVSCAYQVARG
MEYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHDIDYYKKTSNGRLPVKWMAPE
ALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPSHCPPELY
MLMRECWHAVPSQRPTFKQLVEALNKLLTAISEEYLDLSMPFEQYSPAAEDTSSTCSSND
SVFTHEPLAPGGLSPSPFTYHNVRT
Download sequence
Identical sequences F7C211
XP_001381003.2.35504 ENSMODP00000006035 ENSMODP00000006035 13616.ENSMODP00000006035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]