SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006064 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006064
Domain Number 1 Region: 297-395
Classification Level Classification E-value
Superfamily Immunoglobulin 6.01e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 397-489
Classification Level Classification E-value
Superfamily Immunoglobulin 5.51e-21
Family I set domains 0.0042
Further Details:      
 
Domain Number 3 Region: 197-293
Classification Level Classification E-value
Superfamily Immunoglobulin 8.39e-16
Family I set domains 0.0053
Further Details:      
 
Domain Number 4 Region: 90-189
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000046
Family I set domains 0.018
Further Details:      
 
Domain Number 5 Region: 2-89
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000583
Family I set domains 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006064   Gene: ENSMODG00000004909   Transcript: ENSMODT00000006193
Sequence length 490
Comment pep:novel chromosome:BROADO5:4:406557479:406562336:-1 gene:ENSMODG00000004909 transcript:ENSMODT00000006193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPAFWAVPSPVVVQGAELSLLCQGQLGSERFQLWKDGELREERNASGHLAEFSLLNVEGL
RDARSYSCRYGQGALWSELSEPLAVVLTGVFPEPAISISPHSTISPGMTATIWCRISQRA
PDQDVVFALLEAESLEPLQRQSLAETSADFVLPSARAQEAGSYRCIYYTKKAPYRGSHLS
RAQELTVLGNRTREPLPPTLCAQPGLVASAGTKITFWCSRPKLSSLGKVTFTLWKNRTQK
PLQQQVSAEPWTSFLVPLVRPEHTGSYSCTYRENMPSSRDSEPSDLLELVVPGERSLPKP
SLSALPSLVVEPGTHVTLQCRQPPKSPLWGVTFTLLKAGTPQPLQSQSPSGTSAVFPLLS
VRAQDAGNYSCVYSSRTVLYQVSKPSEVLEIWVTDALPKPSLSAWPAPEVVSGASVTLVC
QGATWKTRYVLHKERGEEILPSMDIAQEGAHFFLTRVTPKHSGNYSCSYQVSTNPSLWTK
LSDPLELIVR
Download sequence
Identical sequences F7BGE4
ENSMODP00000006064 ENSMODP00000006064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]