SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006104 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006104
Domain Number 1 Region: 186-258
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000278
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 248-308
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000378
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 3 Region: 60-122
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000675
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 4 Region: 128-184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000139
Family Complement control module/SCR domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006104
Domain Number - Region: 2-41
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0811
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006104   Gene: ENSMODG00000004959   Transcript: ENSMODT00000006233
Sequence length 547
Comment pep:novel chromosome:BROADO5:2:134481192:134736046:-1 gene:ENSMODG00000004959 transcript:ENSMODT00000006233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYHGMNPSSGDAFLEQQQQQQQQQQQHQFPPRLFTVVLWFQLALCLGPAQLTNGYDDLRA
CANPGIPEYGFRIPSGGVFFEDSVARFHCQEGYKLRGPPRRLCMKHLNGSLGWIPTDTPV
CLPEGPDCRLPYIEDADIGNKTYKHGDKLIISCHEGFKIRYPDLYNMASTCRSDGSWDNL
PICQGCLRPLASANGYVNMSEYQSNFPVGAVIAYHCFPGFKLEGSEYLECLYNLIWSYSP
PRCLALEVCPLPPIVSHGDYICHPRPCDRFNHGTVIEFYCDPGYSLTSDYKYITCQYGEW
FPSYQVFCIKSEQIWPNPHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKTHFLPR
GLSGSSSSDPDFVVVDGVPVMLPSYDEAVSSSLNALAPGYLSSVGQGCPMPAEDQSPPAY
PGSGDTDTLPGEGETCDSISGSSELLHSLYSPPMSQAGARPVLERSNAVDATSVEVSTGP
SIDIADGPTAGSQINPLGAKLTPTTPRPRHSFFANDSSSWQCGNVGCLIHASPQFHRYPG
GPQGSSQ
Download sequence
Identical sequences F7FLA7
ENSMODP00000006104 XP_007481522.1.35504 XP_007481523.1.35504 XP_007481524.1.35504 XP_007481525.1.35504 ENSMODP00000006104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]