SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006206 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006206
Domain Number 1 Region: 35-145
Classification Level Classification E-value
Superfamily Immunoglobulin 4.77e-24
Family V set domains (antibody variable domain-like) 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006206   Gene: ENSMODG00000005043   Transcript: ENSMODT00000006336
Sequence length 248
Comment pep:novel chromosome:BROADO5:2:457252719:457259107:-1 gene:ENSMODG00000005043 transcript:ENSMODT00000006336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGDSPAIPIPVLTLLLFSFLVLSPVQAIVVYTDREVHGEVGSKVTLHCSFWSSEWISD
DISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGAFKERIQWVGDPRWKDGSIVIHNLDYS
DNGTFTCDVKNPPDIVGKTSQVTLYVFDKVPTRYGVVLGAVIGGILGLVLLLVLLFYLIR
YCWLRRQAALRRRLSAMEKGKLHKSSKDSSKRGRQTPVLYAMLDHSRSTKAASEKKSKGL
GESRKDKK
Download sequence
Identical sequences F7BER2
ENSMODP00000006206 ENSMODP00000006206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]