SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006231 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006231
Domain Number 1 Region: 31-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000322
Family V set domains (antibody variable domain-like) 0.015
Further Details:      
 
Domain Number 2 Region: 158-267
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000307
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 
Domain Number 3 Region: 428-526
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000508
Family V set domains (antibody variable domain-like) 0.05
Further Details:      
 
Domain Number 4 Region: 564-657
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000898
Family V set domains (antibody variable domain-like) 0.054
Further Details:      
 
Domain Number 5 Region: 827-954
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000197
Family V set domains (antibody variable domain-like) 0.024
Further Details:      
 
Domain Number 6 Region: 301-389
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000852
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Domain Number 7 Region: 962-1003,1036-1078
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000107
Family C1 set domains (antibody constant domain-like) 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006231   Gene: ENSMODG00000005063   Transcript: ENSMODT00000006361
Sequence length 1184
Comment pep:novel chromosome:BROADO5:2:488255989:488411316:-1 gene:ENSMODG00000005063 transcript:ENSMODT00000006361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSPSPGAAMKCCFQALAFLVLLGVVSAQRQVTVQEGPLYRTEGSHITIWCNVSGFQGPS
EQNFQWSIYLPSAPEREVQIVSTIDPSFPYAIYTQRVRTGKIYVERIQGNSALLHITELQ
ARDAGEYECHTPNTDERYFGSYSAKMNLIVIPDSLQATATPQTLQKVEQDSLELTCDVAT
ETSQHSHLSVTWYRQRAGEKPVEVISLSRDFVLHSSSEYAQRQTLGEVRLDKLGETTFRL
TVYHLQTSDQGEFYCEAAEWIQDPDKSWYPMTLKRSEGTVVNVQPTDKEFSVRLETDRRL
YTVGDPVEFRCILEAQNIPDRYFAVSWAFNSSLIASLGPNAVPVLNSEFAQRESRGQLKV
SKESDSVFVLKIYHLRQEDSGKYNCRVTEREKTVTGEFIDKESKRPKNIPIIVLPLKSSI
SVEVTSNASTILEGENLHFSCSVRTADRAQGRFSVIWQLLDRRNRRSNIMWLDRDGTVQP
GSSYWERSSFGGIQMEQVQPNSFTLGIFNSRKEDEGQYECHVTEWVRAVDGEWQIVGERR
ASTPVSITALETGFAVTAISRTPGVTYSESFDLQCIIKPHYPSWVPVSVTWRFQPVGTIE
FHNLVTFTRDGGVQWGERSASFRTRTAIEKAESSNNVRLSISRASDTEAGKYQCVAELWR
KNHNSTWTRLAERTSNLLEIRVLQPGERVKVRKSEREEIITLAQAEPGRASEAPAKVDPE
SILLDIHIYVVKQSKLPHCPCSRTVYFTLYSESIIFVFQGLGSTVYHGSFGIVSLASRGC
WRLIGGQLWCSQGWLLGTSFVWSSLKSEESGGIMRVKRNHENVRLKLSQAQGNITVLETQ
RVELECVVLNRTSGASRLSVEWHVWKPNHPERETVARLSREATFHYGEQVAKNHWKGRLH
LESPSLGVYRLIIQNTAVQDSGTYNCLVEEWLLSPSDVWYKRAEDSSGQTIVTVLRPDAT
LQVDTVVPNVTVPEKSPFQLDCNILSRSSQDSRFAVAWYALRTKAGGKKGNALEDEEIER
KAMLSVGPDAIFGPEGNHWEGRLRFQRLSPVLYRLTVLQADPSDTGNYSCRVEEWLSNPQ
KEWYRLTEEESGPIGIQVLDTGSTLQSIICANDALFYFVFFYPFPIFGILIITILLVRFK
SRNSSKNSEGKNGVPLLWIKEPHLNYSPTCLEPPVLSIHPGTID
Download sequence
Identical sequences F7A7Z0
ENSMODP00000028994 ENSMODP00000006231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]