SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006259 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006259
Domain Number 1 Region: 125-242
Classification Level Classification E-value
Superfamily SEA domain 2.88e-40
Family SEA domain 0.00027
Further Details:      
 
Domain Number 2 Region: 273-395
Classification Level Classification E-value
Superfamily SEA domain 5.62e-40
Family SEA domain 0.00018
Further Details:      
 
Domain Number 3 Region: 425-547
Classification Level Classification E-value
Superfamily SEA domain 9.42e-40
Family SEA domain 0.00017
Further Details:      
 
Domain Number 4 Region: 564-681
Classification Level Classification E-value
Superfamily SEA domain 2.62e-39
Family SEA domain 0.00036
Further Details:      
 
Domain Number 5 Region: 712-833
Classification Level Classification E-value
Superfamily SEA domain 4.71e-34
Family SEA domain 0.00077
Further Details:      
 
Domain Number 6 Region: 3-81
Classification Level Classification E-value
Superfamily SEA domain 1.22e-23
Family SEA domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006259   Gene: ENSMODG00000005087   Transcript: ENSMODT00000006389
Sequence length 833
Comment pep:novel chromosome:BROADO5:3:461938235:461993007:-1 gene:ENSMODG00000005087 transcript:ENSMODT00000006389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGLFKNSSLASSYIGCTLTSLRPMKEGEATGVDVVCAHYKGFTSPVLDPVKVYWELSNQT
YGITRLGPYTLDRDSLFLNGEQPQTIMTTTSSPAFSSLDLLSSSSFSRILSPSCPSPLNL
IFQRERFTMNFTINNMLYTEDMEHPYSEKFSSTERILQHLLRGLFKNSSLASSYIGCTLT
SLRPMKEGEATGVDVVCAHYKGFTSPVLDPVKVYWELSNQTYGITRLGPYTLDRDSLFLN
GEQPRSPIGVPSHPATPDTTASTTAFPWTNVPPAGSYLKVFTLNFTITNLFYTTDMGQKG
SSKFNSTEDVLQYLINSLFRKNSFGSHYFGCRLTLLRSMKNRTATGVDVICAYQEDSSIL
VLDREKIYWELSEQTHGITRLGPYILDKESLYVDGEVRSCTSTISSTFPNHRVTPIQMPT
PPETTWGPSLEGFNLNFTITNLFYTEDMEQRDSIIFKTTEKILQNMLGPLFENSSLGSSY
SSCKLILLRPVKNLTATTVDTICLYQRDSTGPFLDRERVYWEFSNQTGGITRLGPYTLDR
DSLYLNGDVNHEGFSPPSTASGSFSLKSFTLNFTITDLLYTEDMGRPGSQKFKATERVLQ
RLLSPLLENSSLGSDYSGCRLTMLRPVQNGTATKFLCGHWKTPTTPSLDRKKIYWELSNQ
TQGITRLGAYTLDNKSLYLNGKYMNQLARDIKKTSENPKEKFLDENIDYQSLMCPNFESF
TLKFTITNMRYTAEMGERGSSIFMSTERMLQSLLSSLFEKSTLGSQDFTCKLTLLRPMKK
GRATRVHFTCIHQRDPASPVLNREKIYWELSYLTWSITRLGPYTLEKDSLYVN
Download sequence
Identical sequences F7A4E0
ENSMODP00000006259 ENSMODP00000006259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]