SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006262 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006262
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily Fibronectin type III 7.1e-21
Family Fibronectin type III 0.00011
Further Details:      
 
Domain Number 2 Region: 90-187
Classification Level Classification E-value
Superfamily Fibronectin type III 6.51e-18
Family Fibronectin type III 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006262   Gene: ENSMODG00000005088   Transcript: ENSMODT00000006392
Sequence length 315
Comment pep:novel chromosome:BROADO5:X:70070756:70075766:1 gene:ENSMODG00000005088 transcript:ENSMODT00000006392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLPKVQCWVFNVEFMNCTWDNSSGPQSTNLTLYYWYREPRKECGQYIFTGSITSGCWFGS
EDIDIYKNFNLDLLAPGEAGRHSKQEIKLQDQVIPWAPDNLTVSNVSDSQLELNWTNSYK
AMCLEHLVQYKSDIDSGWTEQTVQQRQQFVLPSVDGHKLYTFRVRSRFSPYCGNAQQWSQ
WSHVVQWGGRRPREQPSLPLLETVLIPLGLLTGFIILITMLTRLERVWVILMPRIPNLKS
LDDLVTTHQGNFSTWSGVSKGLAESLQPDYSERLCHVSELPPKTGAQAEGCEVSPCSQHS
PYWVPPPSYSLDPEP
Download sequence
Identical sequences F7A3T7
ENSMODP00000006262 13616.ENSMODP00000006262 ENSMODP00000006262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]