SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006270 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006270
Domain Number 1 Region: 155-258
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000224
Family V set domains (antibody variable domain-like) 0.031
Further Details:      
 
Domain Number 2 Region: 27-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000632
Family V set domains (antibody variable domain-like) 0.028
Further Details:      
 
Domain Number 3 Region: 283-382
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000783
Family V set domains (antibody variable domain-like) 0.034
Further Details:      
 
Domain Number 4 Region: 426-524
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000845
Family V set domains (antibody variable domain-like) 0.054
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006270
Domain Number - Region: 696-814
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000439
Family V set domains (antibody variable domain-like) 0.022
Further Details:      
 
Domain Number - Region: 637-663
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0148
Family I set domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006270   Gene: ENSMODG00000005096   Transcript: ENSMODT00000006400
Sequence length 883
Comment pep:novel chromosome:BROADO5:2:488739000:488824742:1 gene:ENSMODG00000005096 transcript:ENSMODT00000006400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHSEERPLLLLLLALLTLAICQGRIVKIPTGDLVRVEGTELVIPCNVSDYEGPSEQNFD
WSFSSSGTLFVEIVSTWEAAFTAQPYRERLQKGEIQLRRIGNDAVELRIKNLQAADQGQY
KCSTPSTDATVQGNYDDTVQVRVLSDALQVSSKSQPASSLRLKDGDSFELYCSASSTSLE
HTHLSVTWELHRGPARQKILSLTHENRFHPGPQYERRYQSGDLRLDTTGDNTYRLFVSRV
LPVDQGTYRCVVSEWIGEKGKWQEIQEKSVDVATVTIEPTALRATVTKNNVSVTEGDDLD
LTCSIATDQKDDIEAEVTWYFSKVPDSSLPDAHILASMDYHSVVRSPLTVTLNRVGMHSY
RLLVRDANKENSGYYFCHVALWAPGHNRTWQKVAEKMSEPAGVEVILPEPLFEVLLNASK
VPEYSDDPTELECQIADVNHAGANVRFTVSWYYRMDSRSDEVVSDQLLASMDEDWTLRFG
EKSKQRAKNGEIVFSKEDGARFSFRIQRTSEGDKGNYYCVVSAWTRQRNKSWMKSKEVVS
KPVNIFWIAEDSVLLVKARKAKPFFAAGNTFEMTCKVSSEHIKTPRYSVLVTAEKPAADP
FSPNETKHIISLNQDSVVKLENWTDEARADGVVLEKVQDDEFRYRMYQTQVSDAGLYRCV
VTAWSPVGGNQWKEAGTSLSNPIQIDFQTTGPTFNVSVHSDTPTVYRGDLIKLFCIISLE
GASLDPDDMSFDVSWFAVHSFALDKPAVLLSSLDRKGVVNKARRTWKSDLSLEKISVMEF
LLQVHGSEDQDFGNYFCAVIPWVKSTTGSWQRETEIKSKPIFVTVKMDVLNAFKYPLLIG
ISLSTIIGLISCLIGYCSSHWCCKKEVQETRRERRRLMSMEMD
Download sequence
Identical sequences F6ZEK4
13616.ENSMODP00000006270 XP_007485323.1.35504 ENSMODP00000006270 ENSMODP00000006270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]