SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006284 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006284
Domain Number 1 Region: 4-96
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000781
Family V set domains (antibody variable domain-like) 0.046
Further Details:      
 
Domain Number 2 Region: 121-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000137
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 
Domain Number 3 Region: 786-882
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000021
Family V set domains (antibody variable domain-like) 0.026
Further Details:      
 
Domain Number 4 Region: 416-507
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000024
Family I set domains 0.067
Further Details:      
 
Domain Number 5 Region: 535-624
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000541
Family V set domains (antibody variable domain-like) 0.082
Further Details:      
 
Domain Number 6 Region: 651-755
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000561
Family V set domains (antibody variable domain-like) 0.071
Further Details:      
 
Domain Number 7 Region: 267-352
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000437
Family V set domains (antibody variable domain-like) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006284   Gene: ENSMODG00000005103   Transcript: ENSMODT00000006414
Sequence length 906
Comment pep:novel chromosome:BROADO5:2:488846872:488871233:1 gene:ENSMODG00000005103 transcript:ENSMODT00000006414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPLYRAKGYPVSIACNVTGHKGPSEQTFQWSIYQPDKPEREIQIISTKDRTFTYAFYSLR
VQTGDIYVERIQGNSVLLHIGKLQPQDAGKYECHTPSTDGNFFGSYSDTVNLIVIPDTLS
VTMSPQTLNREEGESLALTCEVSKATTQHTHLSVSWYRLPEGGGNQATEIISLSKDFILI
PGSSYTERFLAGDVRLDKTGNTGFRLSIGRLLPVDQGQLFCEATEWIQDPDETWTFITRK
QTDKATVMVQPEDRDFQVNISVVSSFAIGQPLRLICSLLSKSKQNQRLQVVWYLNDTDIG
SIDASGVLDLKKDYEERANLGELQVSKINPKAFTFTISSMGPQDEGVYRCERYWQANARD
GILKELSSSGSGRDWLTLHSGLHGLNHYSPSCSCVLLLISTGTSARLKRTRNGKRLVWEG
ETLIFRCKVNGAGNPLSVVWRHIPVNLQQPELIGSLETDGIVHLGPSYKDRGNRGCIRLE
KENMTTFRLEIFNALMTDGGAYECKVTEFQSKNGGLSWAQKTSVTLNPLNSGLHVTLHSR
QPNVKLGDTADLSCIIRSDYSSLKRLVTVTHNGTVEWGYSQVQWQKKIRISQSSSHSQLL
IHDATKEDTGIYQCQVEAYRRETQHTYGPTRVAAMVVSHPLGINITLPGSQVQEISINME
AEIKCSIISQTKGKIKVSVTWYFLPLSGGTSWLKILKTNQDDIVQYGDDLHTLRRKQKFH
SEKISKDLFQLHILNMDNSDQGTYHCTVEEWLWTTGGSWYKLGEKESEKTELKLKSIGSK
LNVMKTNYTVTTPEHKDVAINCSLENPGNSESLFSVVWFFKEEHSGVTILAEMQHDNILK
YGKEEYGEKLHCYRSSAGDFVLKLQSVEMTDSGTYWCNVEEWQLHANPSKWVSQASDESG
RTQLMV
Download sequence
Identical sequences F6ZDX7
13616.ENSMODP00000006284 ENSMODP00000006284 ENSMODP00000006284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]