SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006516 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000006516
Domain Number - Region: 601-686
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000167
Family Fibronectin type III 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006516   Gene: ENSMODG00000005286   Transcript: ENSMODT00000006651
Sequence length 704
Comment pep:novel chromosome:BROADO5:6:111086839:111136163:-1 gene:ENSMODG00000005286 transcript:ENSMODT00000006651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSGPPAQKILKAKKTMPTSFQKQIHMHKSGNIETLKAIDRNNVHSGNQQLRMDVIHKK
SENSDMKNFLLDSRRNTILPQENETFPQTLALSLKAVKSNSEMNFVNEQVIDPTTRPSET
EDSCKKLFIQDSSDLQKTSCGSEHKANEKKISFEQAKVDLNPKPSSSPSILLNGLINKPA
YILGSHIEKTFNGIWNGKGNHVRPRLEVTSHLDSPVSQQNEAISVIHSNIHLKANKTSNL
KRPVEVRKDTSDFLKTQEYNQINCSSRIDYGNTVSTWHSSFETNNNTSKKRALSGNKENI
KRMKTSNEINENICIVVEEENSLFEQVKCLIRQEVCIVNYKIFDSKLKELNERVDKTQCR
KKHEAIAIQLLRKISRLDRRIKAALAAVQKNGLELKTPTQNMAYKQVTNSKTILLNKNQG
AERDRPNIKLASLNNKSSGSSEIPIPEAKQKKNLTSDCVEVVSESNNADVMMISEENVRL
KAPVTDVEKTVLAKSNDSLGSKTKFKASGGKIKLDDLVIDLTEEANLNCKTASLVQVLEL
PVAANENLKEKKQPIQDSAQVLESFEHLPSLPDIPQHPVLAGFNDSLPPQKFELKLKQVL
KPKGIALTWNISQINPRCAPVESYHLFICHENTTSNSKTAWKKIGEIKALPLPMACTLSQ
FVSSSTYYFTLQAKDIYGRYGPFCDIKYTHGFSEDTKESQILPT
Download sequence
Identical sequences F7E6T7
XP_007498714.1.35504 XP_007498715.1.35504 XP_007498716.1.35504 XP_007498720.1.35504 XP_007498721.1.35504 XP_007498722.1.35504 XP_016279490.1.35504 XP_016279491.1.35504 XP_016279492.1.35504 ENSMODP00000006516 ENSMODP00000006516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]