SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006519 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006519
Domain Number 1 Region: 87-367
Classification Level Classification E-value
Superfamily L domain-like 6.55e-50
Family Ngr ectodomain-like 0.0024
Further Details:      
 
Domain Number 2 Region: 42-109
Classification Level Classification E-value
Superfamily L domain-like 0.000000017
Family Ngr ectodomain-like 0.0062
Further Details:      
 
Domain Number 3 Region: 421-497
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000255
Family Fibronectin type III 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006519   Gene: ENSMODG00000005288   Transcript: ENSMODT00000006654
Sequence length 661
Comment pep:novel chromosome:BROADO5:1:609507927:609509912:1 gene:ENSMODG00000005288 transcript:ENSMODT00000006654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKIPGKTSTVLTMINPTWSIFLIWTKIGLFLKMAPQSVMAKSCPSVCRCDAGFIYCNDRA
LTSIPKGIPEDATTLYLQNNQINNAGIPSELKNLLKVERIYLYHNSLDEFPTNLPKYVKE
LHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEDGAFRDNNYLRLLFLSRNHLST
IPWGLPRTIEELRLDDNRISTISSPSLQDLTSLKRLVLDGNLLNNHGLGDKVFMNLVNLT
ELSLVRNSLTAAPVNLPGTNLRKLYLQENHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQ
GIFDDLDNITQLFLRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDL
NTELFDCKDSGIVSTIQITTAIPNTLYPAQGQKPVSVTKQSEVKNPKLNKDYRTTVSPMR
KIITITVKSVSTETIRISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGDRNEYLVTA
LEPDSPYRICMVPMETSNLYLSDETPVCIETETAPLKMYNPTTTLNREQEKEPYKNSNLP
LAAIIGGAVALVAIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILE
IRETSFQMLPINNEPISKEEFVIHTIFPPNGINLYKSNHSESSSNRSYRDSGIPDSDHSH
S
Download sequence
Identical sequences F7E6S6
13616.ENSMODP00000006519 ENSMODP00000006519 ENSMODP00000006519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]