SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006561 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006561
Domain Number 1 Region: 260-354
Classification Level Classification E-value
Superfamily Immunoglobulin 7.29e-22
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 177-267
Classification Level Classification E-value
Superfamily Immunoglobulin 7.01e-16
Family I set domains 0.044
Further Details:      
 
Domain Number 3 Region: 99-181
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000339
Family I set domains 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006561   Gene: ENSMODG00000005322   Transcript: ENSMODT00000006697
Sequence length 409
Comment pep:novel chromosome:BROADO5:4:283121683:283697359:1 gene:ENSMODG00000005322 transcript:ENSMODT00000006697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVGGYLLLPWRFLVVLSLRLLFLLPTGVPVRSGDATFPKAMDNVTVRQGESATLSLTPA
YGTVTSSEDRCIEEPAQHASNPTVYHNSFERIPGGQEKCTVDNRVTRVAWLNRSTILYAG
NDKWCLDPRVVLLTNTKTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKI
IEISSDISINEGSNISLTCIATGRPEPTVTWRHISPTAVGFMSEDEYLEIQGITRAQSGD
YECSASNDVAAPVVRRVKVTVNYPPYISEAKSTGVAVGQKGTLQCEASAVPSAEFQWYKD
DKRLVGGQKRVKVENRPFLSKLIFFNVSEHDYGNYTCVASNNLGHTNASITLFEINEPTS
SALFQEEKTTVMTPWKAPGAVSEVNNGTSRRAGCIWLLPLLILHLLLKF
Download sequence
Identical sequences F7D282
ENSMODP00000006561 ENSMODP00000006561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]