SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006571 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006571
Domain Number 1 Region: 188-281
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 96-189
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 26-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000169
Family I set domains 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006571   Gene: ENSMODG00000005331   Transcript: ENSMODT00000006707
Sequence length 314
Comment pep:novel chromosome:BROADO5:4:283762713:284226533:-1 gene:ENSMODG00000005331 transcript:ENSMODT00000006707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSLPQGKDKGGGDDIMVKPRDRRCTVDARVTRVAWLNRSTILYAGNDKWSIDPRVVIV
ANTKTQYSIMIQDVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGS
SVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISGITRDQSGEYECSALNDVAAP
DVRKVKITVNYPPYISNAKNTGVSLGQKGILRCEASAVPLAEFQWFKEETRLATGLDGVR
IENKGRMSTLTFFNVSEKDYGNYTCVATNKLGITNASITLYGPGAVIDGVSSASRALACL
WLLGTLFVHFFIKF
Download sequence
Identical sequences F7D1L6
ENSMODP00000006571 ENSMODP00000006571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]