SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006614 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006614
Domain Number 1 Region: 135-231
Classification Level Classification E-value
Superfamily Immunoglobulin 3.02e-25
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 509-701
Classification Level Classification E-value
Superfamily Fibronectin type III 7.43e-24
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 3 Region: 228-324
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-21
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 410-507
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000718
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 28-143
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000214
Family I set domains 0.031
Further Details:      
 
Domain Number 6 Region: 327-424
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000715
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006614   Gene: ENSMODG00000005364   Transcript: ENSMODT00000006751
Sequence length 1445
Comment pep:novel chromosome:BROADO5:4:285874947:285936790:-1 gene:ENSMODG00000005364 transcript:ENSMODT00000006751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWYVATLIASVISTRGLAAQGAHGLREEPEFVTARAGEGVILRCDVIHPVTGQPPPYVV
EWFKFGVPIPIFIKFGYYPPHVDPEYAGRASLHDKASLRLEQVRSEDQGWYECKVLMLDQ
QYDTFHNGSWVHLTINAPPTFTETPPQYIEAKEGGSITLTCTAFGNPKPIVTWLKEGTLL
GPSGKFQVSDGSLTVKSVSRDDRGAYTCRAYSIQGEAVHTTHLLVQGPPFIVSPPENITV
NISQDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDGTLIIFRVKPEDAGK
YTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATLVKWN
KDGRPLQIEKNLGWTLMEDGSIRIEEATEEALGTYTCVPYNTLGTMGQSAPARLVLKDPP
YFTVLPGWEYRQEAGRELLIPCAAAGDPFPVITWRKVGKPSRSKHNALPSGSLQFRALSK
EDHGEWECIATNVVTSITASTHLTVIGTSPHAPSSVRVLVSMTTANVSWEPGYDGGYDQT
FSVWMKRAQFGPHDWLSLPVPPGPSWLLVDTLEPETAYQFSVLAQNKLGTSSFSEVVTVN
TLAFPITTPEPLVLVTPPRCLTANRTQQGVLLSWLPPANHSFPIDHYIMEFRIGERWEIL
DDAILGTDGDFFAKDLSQDTWYEFRVLAVMQDLISEPSNIAGVSSTDIFPQPDLTDDGLA
RPVLAGIVATICFLAAAILFSTLAACFVNKQRKRKLKRKKDPPLSITHCRKSLESPLSSG
KVSPESIRTLRAPSESSDDQGQPAAKRMLSPSREKELSLYKKTKRAISSKKYSVAKAEAE
AEATTPIELISRGPDGRFVMDPSEMEPSLKSRRIEGFPFAEETDMYPEFRQSDEENDDPL
VPTSVAALKSQLTPLSSSQESYLPPPAYSPRFQPRGLEGPSGLEGRLQATGQARPPGPRP
FHHGQYYGYLSSSSPGEVEPPPFYMPEVGSPLSSVMSSPPLHTEGPFGHPTIPEENGENN
SNSTLPLTQTPTGGRSPEPWGRPEFPFGGLESPAMMFPHQLHPCDVAESLQPKACLPRGL
PPTSLQVPAAYPGILSLEAPKSWAGKSPGRGPVPVPTATKWQDKPMQPLVSQGQLRHTSQ
GMGIPVLPYPEPAEPSGHGGPSTFGLDTRWYEPQPRPRPSPRQGRRAEPSLHQVVLQPSR
LSPLTQSPLSSRTGSPELAARARPRPGLLQQAEMSEITLQPPAAVSFSRKSTPSTGSPSQ
SSRGDSPSYRPAMGFTTLATGYPSPPQGPAGPSDSLDVFGQTPSPRRMGEELLRPEPPPT
TLSTSGTPERDFPGSPGQGPPVPNLLPLSSPSAHRSPVPVPTASPKGMLRPSGLGAGRKH
SGPVNGMPGATHPTPTRAPRRKLQTDRQTNKLPRSAWQKEHTLYSSGWYSSYLGSVVETS
LSSAQ
Download sequence
Identical sequences F6YLD1
ENSMODP00000006614 ENSMODP00000006614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]