SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006642 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006642
Domain Number 1 Region: 138-239
Classification Level Classification E-value
Superfamily Immunoglobulin 9.42e-20
Family I set domains 0.0019
Further Details:      
 
Domain Number 2 Region: 37-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000755
Family V set domains (antibody variable domain-like) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006642   Gene: ENSMODG00000005384   Transcript: ENSMODT00000006780
Sequence length 310
Comment pep:novel chromosome:BROADO5:4:286133805:286233147:1 gene:ENSMODG00000005384 transcript:ENSMODT00000006780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSRRLPLRLCPGPSLLVLLLFVRSCLIEAVNLKSSNQNPVVREFESVELSCIITDSQT
NDPRIEWKKIQDDQTTYVFFDNKIQGHLAGRAELLGKTSLKILNVTRSDTASYRCEVVAR
NDHKEIDEIVIDLTVQVKPVAPVCRVPKAVPVGKSATLHCQENEGYPRPHYRWYRNDIPL
PTDSKANPRFRNSSFVLNPETGTLVFNAVHKDDTGQYYCFATNEAGSAHCEGQEMEVYDL
NIAGIIGGVLVVLAVLVLITLGICCAYRRGYFINNKQNGESYKNPGKPDGVNYIRTDDEG
DFRHKSSFVI
Download sequence
Identical sequences F7GGH4
XP_007495219.1.35504 ENSMODP00000006642 ENSMODP00000006642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]