SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006757 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006757
Domain Number 1 Region: 30-131
Classification Level Classification E-value
Superfamily Immunoglobulin 4.91e-18
Family V set domains (antibody variable domain-like) 0.00021
Further Details:      
 
Domain Number 2 Region: 127-220
Classification Level Classification E-value
Superfamily Immunoglobulin 6.11e-17
Family I set domains 0.0000619
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006757   Gene: ENSMODG00000005465   Transcript: ENSMODT00000006895
Sequence length 295
Comment pep:novel chromosome:BROADO5:2:456829654:456867383:-1 gene:ENSMODG00000005465 transcript:ENSMODT00000006895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRAGLRHLLLFLSAASLCCLASGGGSVSTSQDHVKVDENQPVTLSCYFSGFYSPRVEW
KFVKGSTTSLVCFDNKITGPYQDRVEFSQTGIHFRTVTRKDTGTYTCMVTDGTNYGEIAV
QLTVLVPPSKPNVNIPSSATIGHRVILTCSEGEGSPPPDYQWYKDGALMPLDPKKNRAFS
NSSYTINSKTGELVFDPLTAFDSGEYSCQVNNGVGTAMRSEAIRMEAAELNVGGIVAAVF
VTLILLGLLVFGVWFAYTRGYFNRTSKGSATKKVIYSQPSARSDGEFRQTSSFLV
Download sequence
Identical sequences F7CGG4
ENSMODP00000006757 XP_007485011.1.35504 ENSMODP00000006757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]