SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006955 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000006955
Domain Number - Region: 1098-1144
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00741
Family NAD+-dependent DNA ligase, domain 3 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006955   Gene: ENSMODG00000005617   Transcript: ENSMODT00000007095
Sequence length 1483
Comment pep:novel chromosome:BROADO5:6:54598614:54749896:1 gene:ENSMODG00000005617 transcript:ENSMODT00000007095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTLLKYHSVDYLHENVVRKKLSIRSLSLHIPSYLYPDEYNCHAGIVVDEEFRKPWTRVP
VPTTLQLNDFSELYQWKTIFSEDFLEKKTVSYIGSYINNFEEIVPSSNPSSQIDIEENCL
LTQNGDREIFYPITCSEGGPTLQTANQDLYIEDETIFVNTLVEYKKQLPTLNDLLSRLNV
FLLKDPCLDFKEQQILIEADHFREYFPFQSSMEVHEKEELHMIEELFEDEKQLILPIEYD
LLKSAILPERTDIQTLSELKEFIKSTPEIIDDTIENEKLFEKALPTEDQNEIMVECYPRE
KIHTSQNQCESESHEPGDLEMPLTLPYLITEQSLRNPIHVEHQVHQLSPICNINCIPTEE
YTEKCRVQLQSENYQSSLDSLLFKVPQTEEPIIHYSVTDLKKMFSTEVESQMLDSLKEEW
WKEEGLLSMMTDTLEHQTPALCHDSLLPTEEEMLSIKPLQLKWCLEQKCDTISKLKTSSC
MTPQKIPRDDHLSLVQKSPPKNVPHTCVPERKPELISVIDKEEKKEICESQDYKALCIES
PLSSVNHNESFEPARKCKDNLDPLSNFIILRNKHMTMLSEPQVIMDAGQKIESKLQCEEE
YTLTLEEKSPVGCSEPSPEKNQEKEMNVIEIQATDSQCQAYSLLEAVATPLLKELADHAC
LLASNWKFATLGFDQTRFFLKQQEKVINDIFLQGKNAEREVIFKRAALVHLLVTVRDLLL
MCTLDTALGYLRRAKDVYKSMLGSCLENIWRQLEIVQFIRKKETETNHKEQQLYCQMLHF
VQTNNTEEQQFKVLIITRMDSDEEHYFLIKTLSKIKGLKCISLSPEKRNILLESNDILNG
LKKCSCMVIHNQHIGPDFPWTQFSFMMEYNYVENSCWTEHCEQLDIPYMAFKTVLPDEVF
KKSASLDTFGGFLLEIQIPYVFLTSEGLLNTPEILQLLESNYNITLVERCCSESLKQFGD
TDRYVVVTVDECTAIIIQSLEELNCEKASDNFILKLIALSIQYSFCWIIFYSKERLNSEY
CLTGKTLHHLALIYAALVPFGLKSEELEVKLVIMPGVEETAQLIRQIADHILLSSERDPH
EWLDKSWLSVSPTKDEMCLLDFPCINPLVAQLMLNKGPSLPWLLSATLDQLQELLPEVPS
KVIKHFSEITSLFNISSSLPKSPLISSSQENGYQSDNISQCSISSSSASIIQGQDKYYYN
SKLYEKVLEDSSLSSNSKNSLVEPSEIQCILPFSKCYEQTNCWEDSDLNPYQPQYTDFLN
NTESRKTTGTSFPRQNDSESDVFSLGLPQMNYETRMTKNVANSDCINYKGQYTTKGKIKK
ELDAPSFLLENSGYPATWNFKNDILEPQIHPHKLQYGREQTSYYTWFSKKDNLNTISNPF
MFQQNCLSDELKGIMYDRLDAQTDGTSWKELTAFSNVNSSTHNSCAYNLNATSEKLNNLY
VQQTSGRYSGQKRHIATSSNLAKNESLTGNNLLFVENNFKLNF
Download sequence
Identical sequences F7CZ91
ENSMODP00000006955 ENSMODP00000006955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]