SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006960 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006960
Domain Number 1 Region: 190-285
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-22
Family I set domains 0.0033
Further Details:      
 
Domain Number 2 Region: 90-188
Classification Level Classification E-value
Superfamily Immunoglobulin 8.97e-22
Family I set domains 0.0022
Further Details:      
 
Domain Number 3 Region: 1-87
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000271
Family I set domains 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006960   Gene: ENSMODG00000015647   Transcript: ENSMODT00000007100
Sequence length 288
Comment pep:novel chromosome:BROADO5:Un:59940257:59943661:-1 gene:ENSMODG00000015647 transcript:ENSMODT00000007100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPTLSAVPSRLVYYGGNVTLRCQGQVGSDRFQLWKDGELIEEKNVSHSLEWFLLKNVNEM
NFRGSYSCHYRLGTWWSEYSKPLFLYMDGVLPKPTLWAQPGPVVAPGTNITLWCSRPSLS
SVQEWMFTLWKDEMQLPLQQHLSSESQNGFLLSSVSPEDTGSYKCAYKEQNCSNRRSKMS
DALELVVPDVFPKASLSVWPGPEVASGTNVTLLCKGPSWSTKFLLHKEGDDEILHSTDII
QDGALFFFPHVTTKHSGNYTCSYQPSTNGSLWTQHSDPVELTVRGERK
Download sequence
Identical sequences H9H6R9
ENSMODP00000006960 13616.ENSMODP00000019530 ENSMODP00000019530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]