SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006969 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006969
Domain Number 1 Region: 21-103
Classification Level Classification E-value
Superfamily Immunoglobulin 4.75e-30
Family C1 set domains (antibody constant domain-like) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006969   Gene: ENSMODG00000005630   Transcript: ENSMODT00000007109
Sequence length 155
Comment pep:novel chromosome:BROADO5:1:171608012:171634192:1 gene:ENSMODG00000005630 transcript:ENSMODT00000007109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSETNQHIFGKGTQVAVLPNIQNPQPALYQLRSPKSSNTSVCLLTDFGFYNGSIKNETVT
GSEATVLEMMTMESKSYGAVTWGSKSNFTCTDAFRKDMFDFNQFSGSKCNSSHAEQGFET
DRDLNLMNLSLIVLRIIFLKTVGFNLLMTLRLWSN
Download sequence
Identical sequences F7CFC9
ENSMODP00000006969 13616.ENSMODP00000006969 ENSMODP00000006969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]